Skip to Content
Merck
All Photos(2)

Key Documents

L7880

Sigma-Aldrich

β-Lactoglobulin A from bovine milk

≥90% (PAGE)

Sign Into View Organizational & Contract Pricing
All Photos(2)

About This Item

CAS Number:
50863-92-8
MDL number:
MFCD00130636
UNSPSC Code:
12352202
NACRES:
NA.61
Pricing and availability is not currently available.

biological source

bovine milk

Quality Level

200

Assay

≥90% (PAGE)

form

powder

mol wt

18,363 Da by calculation

technique(s)

HPLC: suitable

UniProt accession no.

P02754

storage temp.

2-8°C

Gene Information

bovine ... LGB(280838)

Looking for similar products? Visit Product Comparison Guide

General description

A member of the lipocalin family, βLg is a small protein of 162 amino acids with a molecular mass of ∼18,400 Da, featuring an eight-stranded β-barrel (strands A-H) succeeded by a three-turn a-helix and a final β-strand (strand I) that forms part of the dimerization interface.[1]
Milk from dairy cows contains the protein β-lactoglobulin (BLG). It naturally occurs in a number of genetic variants, and the most prevalent bovine variants are known as BLG A and BLG B.[2]

Application

β-Lactoglobulin A from bovine milk has been used:
  • as a calibrant for the calibration of the TriWave device[3]
  • as a standard in the detection and quantification of β-lactoglobulin in bovine milk by reverse-phase high performance liquid chromatography (HPLC)[4]
  • in the purification and molecular weight measurement of protease samples[5]

β-Lactoglobulin was used in the identification of the genetic variants of κ-casein in milk by isoelectric focusing electrophoresis.[6]

Biochem/physiol Actions

β-Lactoglobulin (β-lg) possesses heat-set gelation properties. It also exhibits antiviral, anticarcinogenic and hypocholesterolemic effects. β-lg can bind to retinol and long-chain fatty acids. It may participate in the absorption and metabolism of fatty acids.[7]

Storage Class Code

11 - Combustible Solids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number
0000403266
0000377455
0000374056
0000326214
0000326244

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Search for a COA

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

An Acid Protease Produced by Monilinia fructigena in vitro and in Infected Apple Fruits, and its Possible Role in Pathogenesis
Hislop EC, et al.
Microbiology, 128(4), 799-807 (1982)
Laurette Tavel et al.
Journal of agricultural and food chemistry, 56(21), 10208-10217 (2008-10-22)
Interactions between beta-lactoglobulin (BLG) in its monomeric form and a wide range of aroma compounds were investigated by Fourier transform infrared (FT-IR) and 2D nuclear magnetic resonance (NMR) spectroscopies. A screening of the ligands was carried out by FT-IR through
Jeremy Pronchik et al.
The journal of physical chemistry. B, 112(36), 11422-11434 (2008-08-19)
We use time-dependent fluorescence Stokes shift (TDFSS) information to study the fluctuation rates of the lipocalin, beta-lactoglobulin A in the vicinity of an encapsulated coumarin 153 molecule. The system has three unique dielectric environments in which the fluorophore binds. We
Bioactive milk proteins, peptides and lipids and other functional components derived from milk and bovine colostrum
Functional Foods, 471-511 (2011)
Detection and quantification of alphaS1-, alphaS2-, beta-, kappa-casein,alpha-lactalbumin, beta-lactoglobulin and lactoferrin in bovine milk by reverse-phase high-performance liquid chromatography
Maurmayr A, et al.
Agriculturae Conspectus Scientificus, 78(3), 201-205 (2013)
View All Related Papers

Questions

1–2 of 2 Questions  

  1. Do you have the amino acid sequence of Product L7880, β-Lactoglobulin A from bovine milk?

    1 answer

    1. Uniprot P02754 describes beta Lactoglobulin.The first 16 amino acids of that sequence are the signal peptide, so the sequence of beta-Lactoglobulin B corresponds to amino acids 17-178.But Product L7880 is beta-Lactoglobulin A. As shown in the details under the first link, this form of the protein varies by two amino acids from beta-Lactoglobulin B:1. Instead of the glycine (G) at position 80 of the B form, the A form has an aspartic acid (D).2. Instead of the alaline (A) at position 134 of the B form, the A form has a valine (V).So to answer your question, the sequence of Product L7880 is:LIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENDECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLVCQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI

      Helpful?

  2. What is the Department of Transportation shipping information for this product?

    1 answer

    1. Transportation information can be found in Section 14 of the product's (M)SDS.To access the shipping information for this material, use the link on the product detail page for the product.

      Helpful?

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service