SAB2108850

Anti-NOX5 (C-terminal) antibody produced in rabbit

affinity isolated antibody

• Synonym(s): GH, GH-N, GHN, IGHD1B, hGH-N
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: rabbit
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 62 kDa
• species reactivity (predicted by homology): bovine, rabbit, human, pig
• concentration: 0.5 mg/mL
• technique(s): western blot: 1 μg/mL
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... NOX5(57396)

Description

General description

This gene is predominantly expressed in the testis and lymphocyte-rich areas of spleen and lymph nodes. It encodes a calcium-dependen NADPH oxidase that generates superoxide, and functions as a calcium-dependent proton channel that may regulate redox-dependent processes in lymphocytes and spermatozoa. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.

Immunogen

Synthetic peptide directed towards the C-terminal region of Human NOX5

Sequence

Synthetic peptide located within the following region: DQAEEAQYGRFLELHMYMTSALGKNDMKAIGLQMALDLLANKEKKDSITG

Physical form

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: nwg
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable