Skip to Content
Merck
All Photos(4)

Documents

HPA035832

Sigma-Aldrich

Anti-CD33 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-FLJ00391, Anti-SIGLEC-3, Anti-SIGLEC3, Anti-p67

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.43

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunohistochemistry: 1:200-1:500

immunogen sequence

KTHRRKAARTAVGRNDTHPTTGSASPKHQKKSKLHGPTETSSCSGAAPTVEMDEELHYASLNFHGMNPSKDTSTEYSEVRTQ

UniProt accession no.

application(s)

research pathology

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... CD33(945)

General description

Myeloid cell surface antigen CD33 (cluster of differentiation 33), also known as SIGLEC3 (sialic acid binding Ig-like lectins) and GP67, belongs to the CD33-related SIGLEC gene family. It is a type 1 transmembrane protein and has two immunoglobulin-like extracellular domains, a single transmembrane area and two intracellular inhibitory motifs. The CD33 gene is located on human chromosome 19q13.

Immunogen

CD33 molecule

Application

Anti-CD33 antibody has been used in immunohistochemical staining.

Biochem/physiol Actions

CD33 (cluster of differentiation 33) is mainly involved in anti-inflammatory signaling, cell adhesion and endocytosis functions. CD33 serves as a myeloid differentiation marker. Mutations in the CD33 gene are associated with Alzheimer′s disease susceptibility and acute myeloid leukemia treatment efficacy.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST71736

Physical form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Genomic organization of the siglec gene locus on chromosome 19q13. 4 and cloning of two new siglec pseudogenes.
Yousef GM, et al.
Gene, 286(2), 259-270 (2002)
Human-specific derived alleles of CD33 and other genes protect against postreproductive cognitive decline.
Schwarz F, et al.
Proceedings of the National Academy of Sciences of the USA, 113(1), 74-79 (2016)
Genetics of CD33 in Alzheimer's disease and acute myeloid leukemia.
Malik M, et al.
Human Molecular Genetics, 24(12), 3557-3570 (2015)
CD33 rs3865444 polymorphism contributes to Alzheimer?s disease susceptibility in Chinese, European, and North American populations.
Li X, et al.
Molecular Neurobiology, 52(1), 414-421 (2015)
Clinicoradiological characteristics, management and prognosis of primary myeloid sarcoma of the central nervous system: A report of four cases.
Yang B, et al.
Oncology Letters, 14(3), 3825-3831 (2017)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service