Skip to Content
Merck
All Photos(3)

Key Documents

AV48174

Sigma-Aldrich

Anti-IGFBP7 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-FSTL2, Anti-IGFBP-7, Anti-IGFBP-7v, Anti-Insulin-like growth factor binding protein 7, Anti-MAC25, Anti-PSF

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

29 kDa

species reactivity

horse, human, rat, guinea pig, dog, bovine, rabbit

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... IGFBP7(3490)

General description

Insulin-like growth factor binding protein 7 (IGFBP7) is a protein that strongly binds to IGF-I and with low affinity to IGF-II. It is known to mediate cell adhesion and the production of prostacyclin. Loss of IGFBP7 expression has been associated with tumorigenesis.
Rabbit Anti-IGFBP7 antibody recognizes human, canine, bovine, pig, mouse, and rat IGFBP7.

Immunogen

Synthetic peptide directed towards the C terminal region of human IGFBP7

Application

Rabbit Anti-IGFBP7 antibody is suitable for western blot applications at a concentration of 1μg/ml.

Biochem/physiol Actions

IGFBP7 contains 1 Ig-like C2-type (immunoglobulin-like) domain, 1 IGFBP N-terminal domain and 1 Kazal-like domain. It binds IGF-I and IGF-II with a relatively low affinity. IGFBP7 stimulates prostacyclin (PGI2) production.

Sequence

Synthetic peptide located within the following region: RGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALH

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Valentina Evdokimova et al.
Science signaling, 5(255), ra92-ra92 (2012-12-20)
Insulin-like growth factor-binding protein 7 (IGFBP7) is a secreted factor that suppresses growth, and the abundance of IGFBP7 inversely correlates with tumor progression. Here, we showed that pretreatment of normal and breast cancer cells with IGFBP7 interfered with the activation
Narendra Wajapeyee et al.
Cell, 132(3), 363-374 (2008-02-13)
Expression of an oncogene in a primary cell can, paradoxically, block proliferation by inducing senescence or apoptosis through pathways that remain to be elucidated. Here we perform genome-wide RNA-interference screening to identify 17 genes required for an activated BRAF oncogene
J Darr et al.
Oncogene, 33(23), 3024-3032 (2013-07-16)
SMARCB1 (Snf5/Ini1/Baf47) is a potent tumor suppressor, the loss of which serves as the diagnostic feature in malignant rhabdoid tumors (MRT) and atypical teratoid/rhabdoid tumors (AT/RT), two highly aggressive forms of pediatric neoplasms. SMARCB1 is a core subunit of Swi/Snf

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service