WH0079872M1

Monoclonal Anti-CBLL1 antibody produced in mouse

clone 4C2, purified immunoglobulin, buffered aqueous solution

• Synonym(s): Anti-Cas-Br-M (murine) ecotropic retroviral transforming sequence-like 1, Anti-FLJ23109, Anti-HAKAI, Anti-RNF188
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 4C2, monoclonal
• form: buffered aqueous solution
• species reactivity: human
• technique(s): immunofluorescence: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG2aκ
• GenBank accession no.: NM_024814
• UniProt accession no.: Q75N03
• shipped in: dry ice
• storage temp.: −20°C
• Gene Information: human ... CBLL1(79872)

Description

General description

Epithelial cell cadherin (CDH1; MIM 192090) is endocytosed as a consequence of tyrosine phosphorylation and ubiquitination. HAKAI is an E3 ubiquitin ligase (see UBE3A; MIM 601623) that mediates ubiquitination of the CDH1 complex.[supplied by OMIM

Immunogen

CBLL1 (NP_079090, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MDHTDNELQGTNSSGSLGGLDVRRRIPIKLISKQANKAKPAPRTQRTINRMPAKAPPGDEEGFDYNEEERYDCKGGELFANQRRFPGHLFWDFQINILGE

Biochem/physiol Actions

CBLL1 (Cbl proto-oncogene-like 1, E3 ubiquitin protein ligase) is an E-cadherin binding protein involved in the ubiquitination of E-cadherin and regulation of E-cadherin complex endocytosis. During ubiquitination, it directly binds to the cytoplasmic domain of E-cadherin. It has been reported in a study that CBLL1 may play a role in neuronal apoptosis and in LPS (Lipopolysaccharide) administration. CBLL1 have also been predicted as a regulator of cell proliferation.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: nwg
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable
• Personal Protective Equipment: dust mask type N95 (US), Eyeshields, Gloves