Skip to Content
Merck
All Photos(6)

Key Documents

HPA043083

Sigma-Aldrich

Anti-PLA2G4C antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-Cpla2-γ, Anti-Phospholipase a2, group ivc (cytosolic, calcium-independent)

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41
Pricing and availability is not currently available.

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50-1:200

immunogen sequence

EAELDLWSKAPASCYILKGETGPVVMHFPLFNIDACGGDIEAWSDTYDTFKLADTYTLDVVVLLLALAKKNVRENKKKILRELMNVAGLYYPKD

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... PLA2G4C(8605)

General description

The gene PLA2G4C (phospholipase A2 group IVC) is mapped to human chromosome 19. The encoded protein belongs to the phospholipase A2 family of proteins. PLA2G4C is mainly expressed in the brain, heart and skeletal muscle. The protein is present in the endoplasmatic reticulum and mitochondria.

Immunogen

phospholipase A2, group IVC (cytosolic, calcium-independent) recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-PLA2G4C antibody produced in rabbit has been used in western blotting, immunofluorescence and immunoprecipitation.

Biochem/physiol Actions

PLA2G4C (phospholipase A2 group IVC) is responsible for the release of fatty acids from phospholipids. It plays an important role in the generation of prostaglandins and remodeling of cellular membrane. Cytoplasmic PLA2G4C participates in arachidonic acid metabolism. PLA2G4C also exhibits lysophospholipase and transacylation activity. Mutation in this gene, rs1549637 (T>A), might be associated with the susceptibility to schizophrenia. Polymorphism in this gene controls the disease outcome in patients with colorectal cancer. It is also involved in the chemotaxis of breast cancer cells. Silencing of this gene suppresses EGF (epidermal growth factor)-mediated chemotaxis in breast cancer cell lines. PLA2G4C variants can increase the levels of prostaglandins, thereby influencing preterm birth risk.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST82579

Physical form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Prognostic significance of PLA2G4C gene polymorphism in patients with stage II colorectal cancer.
Olsen RS, et al.
Acta Oncologica (Stockholm, Sweden), 55, 474-479 (2016)
Primate-specific evolution of noncoding element insertion into PLA2G4C and human preterm birth.
Plunkett J, et al.
BMC Medical Genomics, 3, 62-62 (2010)
Downregulation of cPLA2? expression inhibits EGF-induced chemotaxis of human breast cancer cells through Akt pathway.
Tian G, et al.
Biochemical and Biophysical Research Communications, 409, 506-512 (2011)
Ewa Pniewska-Dawidczyk et al.
International journal of immunopathology and pharmacology, 35, 2058738421990952-2058738421990952 (2021-02-26)
Chronic inflammation in asthmatics is initiated/exacerbated by many environmental factors, such as bacterial lipopolysaccharide and allergens. Phospholipase A2 and histone acetyltransferase/deacetylases are enzymes involved in inflammatory process, particularly in lipid inflammatory mediators production and control of transcription of many inflammatory
Cytosolic phospholipase A2 gamma is involved in hepatitis C virus replication and assembly.
Xu S, et al.
Journal of Virology, 86, 13025-13037 (2012)

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service