Skip to Content
Merck
All Photos(8)

Key Documents

HPA015257

Sigma-Aldrich

Anti-RIPK1 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-Cell death protein RIP, Anti-Receptor-interacting protein, Anti-Receptor-interacting serine/threonine-protein kinase 1, Anti-Serine/threonine-protein kinase RIP

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41
Pricing and availability is not currently available.

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

immunogen sequence

KEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLGMGPVEESWFAPSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPFAQQRPYENFQNTEGKGTAYSSAASHGNAV

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... RIPK1(8737)

General description

RIPK1 (receptor -interacting serine-threonine kinase 1) is a necroptosis regulatory protein. It is a serine-threonine kinase containing a death domain. It contains a kinase domain in its N-terminal, RIP homotypic interaction motif, and its C-terminal contains the death domain.
RIPK1 gene is located at 6p25.2 on the human chromosome.

Immunogen

Receptor-interacting serine/threonine-protein kinase 1 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-RIPK1 antibody produced in rabbit has been used in immunoblotting and immunohistochemistry.

Biochem/physiol Actions

RIPK1 (receptor -interacting serine-threonine kinase 1) acts as a signaling molecule in tumor necrosis factor α (TNFα)-induced necroptosis. Necrostatins interact with this protein, to inhibit necroptosis. When induced by TNFα, it forms a component of the prosurvival complex I, which also includes TRADD (TNFR1-associated DD-protein), TRAF2 (TNF receptor-associated factor 2), cIAP1 (cellular inhibitor of apoptosis protein-1), and cIAP2. It is overexpressed in human melanoma, and acts as an oncogene for the same. This up-regulation is achieved due to NF-κB and TNFα, and results in tumor growth and proliferation.[1] It is also up-regulated in gallbladder cancer, and its suppression results in reduced tumor growth and proliferation. It is also up-regulated in glioblastomas, and this is related to malignancy, as well as poor prognosis in glioblastoma patients. In primary and metastatic osteosarcoma, an anti-tumor agent shikonin is capable of inducing cell death by activating RIPK1.[2]

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST73493

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Zeze Fu et al.
BMC cancer, 13, 580-580 (2013-12-10)
Osteosarcoma is the most frequent primary malignant bone tumor, notorious for its lung metastasis. Shikonin, an effective constituent extracted from Chinese medicinal herb, was demonstrated to induce necroptosis in some cancers. MTT assay was performed to detect cell survival rate
Tilman L R Vogelsang et al.
Frontiers in oncology, 13, 1110939-1110939 (2023-05-18)
The enzymes Receptor-interacting serine/threonine-protein kinase 1 (RIPK1) und 3 (RIPK3) as well as the protein Mixed lineage kinase domain like pseudokinase (pMLKL) play a role in the signaling cascade of necroptosis. This is a form of programmed cell death which
S M Fayaz et al.
Journal of computer-aided molecular design, 28(7), 779-794 (2014-07-02)
Programmed cell death has been a fascinating area of research since it throws new challenges and questions in spite of the tremendous ongoing research in this field. Recently, necroptosis, a programmed form of necrotic cell death, has been implicated in
Single-nucleotide polymorphism rs17548629 in RIPK1 gene may be associated with lung cancer in a young and middle-aged Han Chinese population
Yang S, et al.
Cancer Cell International, 20, 1-11 (2020)
Burkhard Hirsch et al.
Laboratory investigation; a journal of technical methods and pathology, 93(6), 677-689 (2013-04-03)
CD30, a member of the tumor necrosis factor receptor (TNFR) superfamily, is consistently expressed by tumor cells of anaplastic large-cell lymphoma (ALCL). CD30 stimulation induces massive caspase-dependent cell death of ALCL cells in case of canonical NFκB inhibition or proteasome

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service