HPA004938
Anti-PTGDS antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Synonym(s):
Anti-Beta-trace protein, Anti-Cerebrin-28, Anti-Glutathione-independent PGD synthetase, Anti-Lipocalin-type prostaglandin-D synthase, Anti-PGD2 synthase, Anti-PGDS, Anti-PGDS antibody produced in rabbit, Anti-PGDS2, Anti-PTGDS, Anti-Prostaglandin-D2 synthase, Anti-Prostaglandin-H2 D-isomerase precursor
Sign Into View Organizational & Contract Pricing
All Photos(5)
About This Item
Recommended Products
![4-Amino-7-methyl-2,3,4,5-tetrahydrobenzo[b]oxepin-5-ol hydrochloride](/deepweb/assets/sigmaaldrich/product/structures/940/379/8a0023b4-0b21-4f07-835b-5d865c80594b/640/8a0023b4-0b21-4f07-835b-5d865c80594b.png)
biological source
rabbit
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:20-1:50
immunogen sequence
SWLREKKAALSMCKSVVAPATDGGLNLTSTFLRKNQCETRTMLLQPAGSLGSYSYRSPHWGSTYSVSVVETDYDQYALLYSQGSKGPGEDFRMATLYSRTQT
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... PTGDS(5730)
General description
Lipocalin-type prostaglandin D2 (PGD2) synthase (PTGDS) is responsible for the synthesis of prostaglandin D2 (PGD2). PTGDS belongs to the lipocalin ligand-carrier protein family. PTGDS is also called glutathione (GSH)- independent PGDS and is a brain type PGDS, which is found in rat brain, spinal cord, epididymis, cochlea, retina and is also found in extracellular space. In humans, PTGDS gene is located on the HSA9q34 loci of chromosome.
Immunogen
Prostaglandin-H2 D-isomerase precursor recombinant protein epitope signature tag (PrEST)
Application
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Biochem/physiol Actions
PTGDS is an important enzyme in the arachidonic pathway where it converts prostaglandin H2 (PGH2) to PGD2. PTGDS also functions as a transporter, and it has been suggested that it transports ligands such as retinoic acid, gangliosides, bile pigments and amyloid β peptides. PTGDS is also responsible for the development of male reproducitve organs and the regulation of sleep, pain sensation and allergy. Mice with unilateral cryptorchidism with second phase of testicular decent are found to be homozygous or heterozygous PTGDS deficient. Expression of PTGDS is also found to vary between manic and depressive states in patients with rapid cycling bipolar disorder. It is also expressed differentially between attention deficit hyperactivity disorder (ADHD) patients and bipolar disorder patients. PTGDS is less expressed in patients with bipolar disorder than in ADHD patients.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Linkage
Corresponding Antigen APREST70110
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Personal Protective Equipment
dust mask type N95 (US), Eyeshields, Gloves
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Lipocalin-type prostaglandin D synthase in human male reproductive organs and seminal plasma.
Tokugawa Y
Biology of Reproduction, 58(2), 600-607 (1998)
Prostaglandin D2 induces nuclear import of the sex-determining factor SOX9 via its cAMP-PKA phosphorylation.
Malki S
The Embo Journal, 24(10), 1798-1809 (2005)
Reduced mRNA expression of PTGDS in peripheral blood mononuclear cells of rapid-cycling bipolar disorder patients compared with healthy control subjects.
Munkholm K
The International Journal of Neuropsychopharmacology, 18(5), pyu101-pyu101 (2014)
Jean-Charles Nault et al.
Gastroenterology, 152(4), 880-894 (2016-12-13)
Hepatocellular adenomas (HCAs) are benign liver tumors that can be assigned to molecular subtypes based on inactivating mutations in hepatocyte nuclear factor 1A, activating mutations in β-catenin, or activation of inflammatory signaling pathways. We aimed to update the classification system
Comparative mapping of lipocalin genes in human and mouse: the four genes for complement C8 gamma chain, prostaglandin-D-synthase, oncogene-24p3, and progestagen-associated endometrial protein map to HSA9 and MMU2.
Chan P
Genomics, 23(1), 145-150 (1994)
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service