Skip to Content
Merck
All Photos(2)

Key Documents

AV32479

Sigma-Aldrich

Anti-NCOR1 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-Nuclear receptor co-repressor 1

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Pricing and availability is not currently available.

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

270 kDa

species reactivity

mouse, dog, human, bovine

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... NCOR1(9611)

General description

Nuclear receptor co-repressor 1/thyroid-hormone- and retinoic-acid-receptor-associated co-repressor 1 (NCOR1, TRAC-1) is a transcriptional coregulatory protein that recruits histone deacetylases to DNA promoter regions and assists nuclear receptors in the down regulation of RNA expression. NCOR1 controls thyroid hormone sensitivity and the set point of the hypothalamic-pituitary-thyroid axis. NCOR1 plays an adaptive role in muscle physiology.
Rabbit polyclonal anti-NCOR1 antibody reacts with human, canine, and mouse nuclear receptor co-repressor 1 transcriptional coregulatory proteins.

Immunogen

Synthetic peptide directed towards the N terminal region of human NCOR1

Application

Rabbit Anti-NCOR1 antibody can be used for western blot applications at a concentration of 0.5μg/ml.
Rabbit polyclonal anti-NCOR1 antibody is used to tag nuclear receptor co-repressor 1 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of nuclear receptor co-repressor 1 in the hypothalamic-pituitary-thyroid axis regulation and muscle physiology.

Biochem/physiol Actions

NCOR1 mediates ligand-independent transcription repression of thyroid-hormone and retinoic-acid receptors by promoting chromatin condensation and preventing access of the transcription machinery. It is part of a complex which also includes histone deacetylases and transcriptional regulators similar to the yeast protein Sin3p.

Sequence

Synthetic peptide located within the following region: NENYKALVRRNYGKRRGRNQQIARPSQEEKVEEKEEDKAEKTEKKEEEKK

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Qingyun Peng et al.
International journal of biological sciences, 16(15), 2974-2988 (2020-10-17)
Sepsis-induced myocardial dysfunction (SIMD) is a life-threatening complication caused by inflammation, but how it is initiated is still unclear. Several studies have shown that extracellular high mobility group box 1 (HMGB1), an important cytokine triggering inflammation, is overexpressed during the

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service