Skip to Content
Merck
All Photos(7)

Key Documents

WH0010146M1

Sigma-Aldrich

Monoclonal Anti-G3BP antibody produced in mouse

clone 2F3, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-HDHVIII, Anti-Ras-GTPase-activating protein SH3-domain-binding protein

Sign Into View Organizational & Contract Pricing


About This Item

MDL number:
UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

2F3, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

ELISA: suitable
capture ELISA: suitable
immunofluorescence: suitable
immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
western blot: 1-5 μg/mL

isotype

IgG1κ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... G3BP1(10146)

General description

G3BP1 (Ras-GTPase-activating protein SH3 domain-binding protein 1) is a constituent of stress granules. It is located on human chromosome 5q14.2-5q33.3.

Immunogen

G3BP (AAH06997, 214 a.a. ~ 303 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
KPEPVLEETAPEDAQKSSSPAPADIAQTVQEDLRTFSWASVTSKNLPPSGAVPVTGIPPHVVKVPASQPRPESKPESQIPPQRPQRDQRV

Biochem/physiol Actions

G3BP1 (Ras-GTPase-activating protein SH3 domain-binding protein 1) blocks the replication of HIV-1 (human immunodeficiency virus) in macrophages and T-cells. In gastric cancer patients, overexpression of G3BP1 leads to imperfect clinical predictions. It is crucial for the interactions of SG–PB (stress granule-processing bodies).

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Novel Role of Ras-GTPase Activating Protein SH3 Domain-Binding Protein
G3BP in Adhesion and Migration of 32D Myeloid Progenitor Cells
Kerstin Schwarz
The Open Hematology Journal (2012)
Sundararaghavan Pattabiraman et al.
Scientific reports, 10(1), 19525-19525 (2020-11-13)
Vimentin is one of the first cytoplasmic intermediate filaments to be expressed in mammalian cells during embryogenesis, but its role in cellular fitness has long been a mystery. Vimentin is acknowledged to play a role in cell stiffness, cell motility
G3BP1 restricts HIV-1 replication in macrophages and T-cells by sequestering viral RNA.
Cobos J
Virology (2015)
G3BP1 promotes stress-induced RNA granule interactions to preserve polyadenylated mRNA
Anais A
The Journal of Cell Biology (2015)
Overexpression of Ras-GTPase-activating protein SH3 domain-binding protein 1 correlates with poor prognosis in gastric cancer patients.
Min L
Histopathology (2015)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service