WH0057167M3

Monoclonal Anti-SALL4 antibody produced in mouse

clone 6E3, purified immunoglobulin, buffered aqueous solution

• Sinónimos: Anti-DRRS, Anti-HSAL4, Anti-MGC133050, Anti-dJ1112F19.1, Anti-sal-like 4 (Drosophila)
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 6E3, monoclonal
• form: buffered aqueous solution
• species reactivity: human, mouse, rat
• technique(s): ELISA: suitable; capture ELISA: suitable; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; western blot: 1-5 μg/mL
• isotype: IgG1κ
• GenBank accession no.: NM_020436
• UniProt accession no.: Q9UJQ4
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... SALL4(57167)

Descripción

General description

Spalt like transcription factor 4 (SALL4) is encoded by the gene with four exons, mapped to human chromosome 20q13.13-q13.2. The encoded protein belongs to the spalt-like protein family. SALL4 is characterized with a multiple zinc finger (ZnF) domains including one N-terminal C2HC-type ZnF and seven C2H2-type ZnF domains. In vertebrates, SALL4 is abundantly expressed in both embryonic and adult stem/stem-like cells.

The protein encoded by this gene may be a zinc finger transcription factor. Defects in this gene are a cause of Duane-radial ray syndrome (DRRS). (provided by RefSeq)

Immunogen

SALL4 (NP_065169, 954 a.a. ~ 1053 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PKEILAPSVNVDPVVWNQYTSMLNGGLAVKTNEISVIQSGGVPTLPVSLGATSVVNNATVSKMDGSQSGISADVEKPSATDGVPKHQFPHFLEENKIAVS

Application

Monoclonal Anti-SALL4 antibody produced in mouse has been used in immunohistochemical staining.

Biochem/physiol Actions

Spalt like transcription factor 4 (SALL4) plays a crucial role in the regulation of cell stemness in biological development and tumor growth. Thus, this protein can be considered as a potent target for gene therapy. In addition, it also serves as a potential diagnostic marker for testicular germ cell tumors (GCTs). Polymorphisms in the gene are associated with the development of various diseases such as Duane-radial ray syndrome (DRRS, Okihiro syndrome), acro-renal-ocular syndrome (AROS), and SALL4-related Holt-Oram syndrome (HOS).

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 12 - Non Combustible Liquids
• wgk_germany: nwg
• flash_point_f: Not applicable
• flash_point_c: Not applicable
• ppe: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)