WH0007855M1

Monoclonal Anti-FZD5 antibody produced in mouse

clone 6A3, purified immunoglobulin, buffered aqueous solution

• Sinónimos: Anti-HFZ5, Anti-frizzled homolog 5 (Drosophila)
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 6A3, monoclonal
• form: buffered aqueous solution
• species reactivity: human
• technique(s): immunoprecipitation (IP): suitable; indirect ELISA: suitable; proximity ligation assay: suitable; western blot: 1-5 μg/mL
• isotype: IgG2aκ
• GenBank accession no.: NM_003468
• UniProt accession no.: Q13467
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... FZD5(7855)

Descripción

General description

The frizzled class receptor 5 (FZD5) gene encodes a receptor FZ5 for Wnt proteins and it is localized on human chromosome 2q33.3.

Immunogen

FZD5 (ENSP00000354607, 72 a.a. ~ 161 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PLVEIQCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGRDAEVLCMDYNRSEATTAPPR

Biochem/physiol Actions

Frizzled class receptor 5 (FZD5) is a receptor component for the canonical and non-canonical Wnt signaling pathways, which is necessary for cell proliferation and cell differentiation. It might serve as an important biomarker for eye malformation. The Wnt5a-FZD5 complex is known to support the functions of innate immunity. Fzd5, along with GCM1 (chorion-specific transcription factor), is involved in a feedback mechanism that regulates trophoblast differentiation and chorionic branching in placenta.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 10 - Combustible liquids
• flash_point_f: Not applicable
• flash_point_c: Not applicable
• ppe: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)