Saltar al contenido
Merck
Todas las fotos(3)

Documentos clave

WH0007038M1

Sigma-Aldrich

Monoclonal Anti-TG antibody produced in mouse

clone 1G3, purified immunoglobulin, buffered aqueous solution

Sinónimos:

Anti-AITD3, Anti-thyroglobulin

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Número MDL:
Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

mouse

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

purified immunoglobulin

tipo de anticuerpo

primary antibodies

clon

1G3, monoclonal

Formulario

buffered aqueous solution

reactividad de especies

human

técnicas

immunofluorescence: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

isotipo

IgG1κ

Nº de acceso GenBank

Nº de acceso UniProt

Condiciones de envío

dry ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... TG(7038)

Categorías relacionadas

Descripción general

Thyroglobulin (TG) is a 660 kDa homodimeric glycoprotein, secreted by endoplasmic reticulum. The gene is located on human chromosome 8q24.22. It is majorly expressed in thyroid gland.

Inmunógeno

TG (NP_003226, 2659 a.a. ~ 2768 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
FSHFIRSGNPNYPYEFSRKVPTFATPWPDFVPRAGGENYKEFSELLPNRQGLKKADCSFWSKYISSLKTSADGAKGGQSAESEEEELTAGSGLREDLLSLQEPGSKTYSK

Acciones bioquímicas o fisiológicas

Thyroglobulin (TG) regulates iodide storage and synthesis of thyroid hormones, thyroxine (T4) and triiodothyronine (T3). Mutations in TG is associated with goiter and congenital hypothyroidism. Polymorphisms in this gene is linked to autoimmune thyroid diseases (AITD) like, Graves′ disease and Hashimoto thyroiditis.

Forma física

Solution in phosphate buffered saline, pH 7.4

Información legal

GenBank is a registered trademark of United States Department of Health and Human Services

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Equipo de protección personal

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Thyroglobulin gene mutations in Chinese patients with congenital hypothyroidism
Hu X, et al.
Molecular and Cellular Endocrinology, 423, 60-66 (2016)
Association of the polymorphisms in the gene encoding thyroglobulin with the development and prognosis of autoimmune thyroid disease
Mizuma T, et al.
Autoimmunity, 50(6), 386-392 (2017)
Novel mutational mechanism in the thyroglobulin gene: imperfect DNA inversion as a cause for hereditary hypothyroidism
Citterio CE, et al.
Molecular and Cellular Endocrinology, 381(1-2), 220-229 (2013)
Thyroglobulin from molecular and cellular biology to clinical endocrinology
Di JB and Arvan P
Endocrine Reviews, 37(1), 2-36 (2015)

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico