Saltar al contenido
Merck
Todas las fotos(7)

Documentos clave

WH0000308M1

Sigma-Aldrich

Monoclonal Anti-ANXA5 antibody produced in mouse

clone 1F4-1A5, purified immunoglobulin, buffered aqueous solution

Sinónimos:

ANX5, ENX2, PP4, annexin A5

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.43

origen biológico

mouse

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

purified immunoglobulin

tipo de anticuerpo

primary antibodies

clon

1F4-1A5, monoclonal

Formulario

buffered aqueous solution

reactividad de especies

human

técnicas

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
immunoprecipitation (IP): suitable
indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

isotipo

IgG1κ

Nº de acceso GenBank

Nº de acceso UniProt

Condiciones de envío

dry ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... ANXA5(308)

Descripción general

The annexin A5 (ANXA5) gene is mapped to human chromosome 4q26-q28 and spans a length of 28kb containing 13 exons and 12 introns. ANXA5 is a member of the annexin family of calcium and membrane-binding proteins that have anti-coagulatory and anti-inflammatory properties. The encoded protein is 320 amino acid long and is folded into four domains, each having five α-helices, forming a superhelical globular structure.
The protein encoded by this gene belongs to the annexin family of calcium-dependent phospholipid binding proteins some of which have been implicated in membrane-related events along exocytotic and endocytotic pathways. Annexin 5 is a phospholipase A2 and protein kinase C inhibitory protein with calcium channel activity and a potential role in cellular signal transduction, inflammation, growth and differentiation. Annexin 5 has also been described as placental anticoagulant protein I, vascular anticoagulant-alpha, endonexin II, lipocortin V, placental protein 4 and anchorin CII. The gene spans 29 kb containing 13 exons, and encodes a single transcript of approximately 1.6 kb and a protein product with a molecular weight of about 35 kDa. (provided by RefSeq)

Inmunógeno

ANXA5 (AAH01429, 1 a.a. ~ 320 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD

Aplicación

The annexin A5 (ANXA5) gene is mapped to human chromosome 4q26-q28 and spans a length of 28kb containing 13 exons and 12 introns. ANXA5 is a member of the annexin family of calcium and membrane-binding proteins that have anti-coagulatory and anti-inflammatory properties. The encoded protein is 320 amino acid long and is folded into four domains, each having five α-helices, forming a superhelical globular structure.

Acciones bioquímicas o fisiológicas

Annexins are a family of water-soluble proteins that bind to membranes and phospholipids in a calcium-dependent manner. They participate in several cellular functions, such as membrane fusion and cytoskeletal interaction. ANXA5 is a potent anticoagulant and serves as a voltage-gated calcium channel when bound to membrane in vitro. It is found to inhibit phospholipase A2 and protein kinase C.

Características y beneficios

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Forma física

Solution in phosphate buffered saline, pH 7.4

Información legal

GenBank is a registered trademark of United States Department of Health and Human Services

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Equipo de protección personal

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Organization of the human annexin V (ANX5) gene.
Cookson BT
Genomics, 20, 463-467 (1994)
Crystal and molecular structure of human annexin V after refinement. Implications for structure, membrane binding and ion channel formation of the annexin family of proteins.
Huber R
Journal of Molecular Biology, 223, 683-704 (1992)
The crystal and molecular structure of human annexin V, an anticoagulant protein that binds to calcium and membranes.
Huber R
The Embo Journal, 9, 3867-3874 (1990)
Karen Oliva et al.
The Journal of endocrinology, 218(2), 165-178 (2013-05-28)
Gestational diabetes mellitus (GDM) is a significant risk factor for the type 2 diabetes epidemic in many populations. Maternal adipose tissue plays a central role in the pathophysiology of GDM. Thus, the aim of this study was to determine the

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico