SAB2108849

Anti-PIEZO2 (N-terminal) antibody produced in rabbit HRP conjugated

affinity isolated antibody

• Sinónimos: GH, GH-N, GHN, IGHD1B, hGH-N
• UNSPSC Code: 12352203
• NACRES: NA.45

Propiedades

• biological source: rabbit
• conjugate: peroxidase conjugate
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 77 kDa
• species reactivity (predicted by homology): mouse, human, canine, rat, horse, bovine, guinea pig, rabbit
• concentration: 0.5 mg/mL
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... PIEZO2(63895)

Descripción

General description

Piezos are large transmembrane proteins conserved among various species, all having between 24 and 36 predicted transmembrane domains. ′Piezo′ comes from the Greek ′piesi,′ meaning ′pressure.′ The PIEZO2 protein has a role in rapidly adapting mechanically activated (MA) currents in somatosensory neurons.

Immunogen

Synthetic peptide directed towards the N-terminal region of Human PIEZO2

Sequence

Synthetic peptide located within the following region: VFGFWAFGKHSAAADITSSLSEDQVPGPFLVMVLIQFGTMVVDRALYLRK

Physical form

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 12 - Non Combustible Liquids
• wgk_germany: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable