Saltar al contenido
Merck

MSST0016

Sigma-Aldrich

SILuLite B2M beta-2-microglobulin human

recombinant, expressed in HEK 293 cells, MS Protein Standard

Sinónimos:

β-2-microglobulin, Mass spectrometry standard, B@M, Mass spectrometry standard, beta-2-microglobulin

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
23201100
NACRES:
NA.12

origen biológico

human

Nivel de calidad

recombinante

expressed in HEK 293 cells

Ensayo

≥98% (SDS-PAGE)

Formulario

lyophilized powder

técnicas

mass spectrometry (MS): suitable

idoneidad

suitable for mass spectrometry (internal calibrator)

Nº de acceso UniProt

temp. de almacenamiento

−20°C

Información sobre el gen

human ... B2M(567)

Descripción general

SILu Lite B2M is a recombinant human protein expressed in human 293 cells. It is a monomer of 119 amino acids (including C-terminal polyhistidine and flag tags), with a molecular weight of ~14 kDa. SILu Lite B2M is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.
Suggested Quantitative Analysis Parameters
(MRM settings provided for three suggested peptides)

Acciones bioquímicas o fisiológicas

B2M is the light chain of the major histocompatibility class (MHC) I molecule expressed on the cell surface of all nucleated cells. Increased urinary B2M excretion has been observed to be an early marker of tubular injury in a number of settings, including nephrotoxicant exposure, cardiac surgery, and renal transplantation, preceding rises in serum creatinine by as many as 4−5 days. B2M may also serve as an early biomarker for AKI (Acute Kidney Injury).

Secuencia

IQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDMDYKDDDDKGHHHHHHHHGGQ

Forma física

Supplied as a lyophilized powder containing phosphate buffered saline.

Información legal

This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), [email protected].
SILu is a trademark of Sigma-Aldrich Co. LLC

Código de clase de almacenamiento

11 - Combustible Solids

Clase de riesgo para el agua (WGK)

WGK 2

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico