Saltar al contenido
Merck
Todas las fotos(2)

Documentos clave

HPA036528

Sigma-Aldrich

Anti-WAC antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinónimos:

Anti-BM-016, Anti-FLJ31290, Anti-MGC10753, Anti-PRO1741, Anti-WW domain containing adaptor with coiled-coil, Anti-Wwp4

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
Atlas de proteínas humanas número:
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Línea del producto

Prestige Antibodies® Powered by Atlas Antibodies

Formulario

buffered aqueous glycerol solution

reactividad de especies

human

técnicas

immunohistochemistry: 1:50- 1:200

secuencia del inmunógeno

RLSDGCHDRRGDSQPYQALKYSSKSHPSSGDHRHEKMRDAGDPSPPNKMLRRSDSPENKYSDSTGHSKAKNVHTHRVRERDGGTSYSPQENSH

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... WAC(51322)

Descripción general

WAC (WW domain-containing adaptor protein) is present on human chromosome 10p12.1. It has a coiled coil domain and exists in four isoforms.

Inmunógeno

WW domain containing adaptor with coiled-coil recombinant protein epitope signature tag (PrEST)

Aplicación

Anti-WAC antibody produced in rabbit can be used for the detection of WAC protein in human embryonic kidney cells 293 lysate by immunoblotting. It may also be used for the detection of WAC proteins in HeLa cells by immunoblotting.

Acciones bioquímicas o fisiológicas

WW domain-containing protein associates with Golgi matrix protein 120 and regulates generation of autophagosomes. During amino acid starvation, WAC also interacts with Golgi protein short coiled-coil protein (SCOC) to mediate autophagy. The coiled coil domain of WAC interacts with ubiquitin-protein ligase complex and aids in ubiquitination of histone H2B, favoring gene expression. WAC assists in the activation and entry of polo-like kinase into mitotic cycle. Microdeletions and de novo mutation in the WAC genome locus is associated with behavior disorders, developmental delay and facial abnormalities in children. Nonsense and frameshift mutations in the WAC gene results in a truncated protein product leading to hypotonia, interrupted development and dysmorphic facial features.

Características y beneficios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST80181

Forma física

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 1

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Activation of ULK kinase and autophagy by GABARAP trafficking from the centrosome is regulated by WAC and GM130
Joachim J, et al.
Molecular Cell, 60(6), 899-913 (2015)
WAC, a functional partner of RNF20/40, regulates histone H2B ubiquitination and gene transcription
Zhang F and Yu X
Molecular Cell, 41(4), 384-397 (2011)
Genome-wide siRNA screen reveals amino acid starvation-induced autophagy requires SCOC and WAC
McKnight NC, et al.
The Embo Journal, 31(8), 1931-1946 (2012)
WAC, a novel WW domain-containing adapter with a coiled-coil region, is colocalized with splicing factor SC35
Xu GM and Arnaout MA
Genomics, 79(1), 87-94 (2002)
A de novo 10p11. 23-p12. 1 deletion recapitulates the phenotype observed in WAC mutations and strengthens the role of WAC in intellectual disability and behavior disorders
Abdelhedi F, et al.
American Journal of Medical Genetics. Part A, 170(7), 1912-1917 (2016)

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico