HPA029691

Anti-SIRT4 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, ab1

• Sinónimos: Anti-SIR2L4, Anti-sirtuin (silent mating type information regulation 2 homolog) 4 (S. cerevisiae)
• MDL number: MFCD07784766
• UNSPSC Code: 12352203
• Human Protein Atlas Number: HPA029691
• NACRES: NA.41

Propiedades

• biological source: rabbit
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• product line: Prestige Antibodies^® Powered by Atlas Antibodies
• form: buffered aqueous glycerol solution
• species reactivity: human
• enhanced validation: recombinant expression; Learn more about Antibody Enhanced Validation
• technique(s): immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:50-1:200
• immunogen sequence: VLQERFQVLNPTWSAEAHGLAPDGDVFLSEEQVRSFQVPTCVQCGGHLKPDVVFFGDTVNPDKVDFVHKRVKEADSLLVVGS
• UniProt accession no.: Q9Y6E7
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... SIRT4(23409)

Descripción

General description

SIRT4 (sirtuin 4) belongs to sirtuin family of nicotinamide adenine dinucleotide-dependent enzymes. It is a NAD⁺-dependent ADP ribosyltransferase, that is located in the mitochondria. SIRT4 protein level is found to be more in ESCC (esophageal squamous cell carcinoma) tissues.

Immunogen

sirtuin (silent mating type information regulation 2 homolog) 4 (S. cerevisiae) recombinant protein epitope signature tag (PrEST)

Application

Anti-SIRT4 has been used in immunohistochemistry.

Biochem/physiol Actions

SIRT4 (sirtuin 4) may involve in the development of esophageal cancer. Growth of HeLa cells can be suppressed by the overexpression of SIRT4. It modulates glutamine metabolism and may also act as a tumor suppressor. It plays some important roles in multiple cellular processes like stress response and longevity. It may act as an important therapeutic target in colorectal cancer.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST78151

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable