Saltar al contenido
Merck
Todas las fotos(8)

Documentos clave

HPA010807

Sigma-Aldrich

Anti-B4GALT1 antibody produced in rabbit

enhanced validation

Ab2, Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinónimos:

Anti-β-1,4-GalTase 1 antibody produced in rabbit, Anti-β-1,4-Galactosyltransferase 1 antibody produced in rabbit, Anti-β4Gal-T1 antibody produced in rabbit, Anti-UDP-Gal:β-GlcNAc β-1,4-galactosyltransferase 1 antibody produced in rabbit, Anti-UDP-galactose:β-N-acetylglucosamine β-1,4-galactosyltransferase 1 antibody produced in rabbit, Anti-b4Gal-T1 antibody produced in rabbit

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
Atlas de proteínas humanas número:
NACRES:
NA.43

origen biológico

rabbit

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Línea del producto

Prestige Antibodies® Powered by Atlas Antibodies

Formulario

buffered aqueous glycerol solution

reactividad de especies

human

validación mejorada

independent
orthogonal RNAseq
Learn more about Antibody Enhanced Validation

técnicas

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:500-1:1000

secuencia del inmunógeno

LPQLVGVSTPLQGGSNSAAAIGQSSGELRTGGARPPPPLGASSQPRPGGDSSPVVDSGPGPASNLTSVPVPHTTALSLPACPEESPLLVGPMLIEFNMPVDLELVAKQNPNVKM

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... B4GALT1(2683)

¿Está buscando productos similares? Visita Guía de comparación de productos

Descripción general

B4GALT1 (UDP-Gal:βGlcNAc β 1,4- galactosyltransferase, polypeptide 1) belongs to a family of type II transmembrane proteins called glycosyltransferases, which resides in Golgi apparatus. This family consists of seven members, from GALT1 to GALT7. B4GALT1 has two isoforms, having different cellular locations, because of differences in their cytoplasmic domains. The long isoform is localized to the cell surface, whereas the short isoform is found in the Golgi apparatus. This gene is located on human chromosome 9p13, and codes for a protein containing 398 amino acids. It is expressed in most tissues, excluding adult brain and fetal heart and brain.

Inmunógeno

β-1,4-Galactosyltransferase 1 recombinant protein epitope signature tag (PrEST)

Aplicación

Anti-B4GALT1 antibody produced in rabbit has been used in immunofluorescence microscopyand immunoblotting.

Acciones bioquímicas o fisiológicas

B4GALT1 (UDP-Gal:βGlcNAc β 1,4- galactosyltransferase, polypeptide 1) is responsible for the synthesis of galactose β-1,4-N-acetylglucosamine (Galβ1-4GlcNAc) groups on glycoproteins, on their N-linked sugar chains. This is performed by the short isoform of B4GALT1, which resides in Golgi bodies. The long isoform, localized to the cell surface, helps in cell adhesion, by interacting with N-acetylglucosamine containing oligosaccharides, which are found in the extracellular matrix. In patients with rheumatoid arthritis, it is involved in the inflammatory response in the synovial tissue. B4GALT1 plays an important role in the proliferation of MCF-7 breast cancer cells by interacting with estrogen receptor. It is methylated and down-regulated in colorectal cancer patients, and hence, can act as a marker of invasive phenotype of colorectal cancer.

Características y beneficios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST71676

Forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 1

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Equipo de protección personal

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Maria Podinovskaia et al.
eLife, 10 (2021-12-01)
Cell-cell communication is an essential process in life, with endosomes acting as key organelles for regulating uptake and secretion of signaling molecules. Endocytosed material is accepted by the sorting endosome where it either is sorted for recycling or remains in
The dimeric structure of wild-type human glycosyltransferase B4GalT1
Harrus D, et al.
Testing, 13(10), e0205571-e0205571 (2018)
Calreticulin Is Involved in Invasion of Human Extravillous Trophoblasts Through Functional Regulation of Integrin beta 1
Yamamoto M, et al.
Endocrinology, 158(11), 3874-3889 (2017)
Engineered sialylation of pathogenic antibodies in vivo attenuates autoimmune disease
Pagan JD, et al.
Cell, 172(3), 564-577 (2018)
Deborah Harrus et al.
PloS one, 13(10), e0205571-e0205571 (2018-10-24)
Most glycosyltransferases, including B4GalT1 (EC 2.4.1.38), are known to assemble into enzyme homomers and functionally relevant heteromers in vivo. However, it remains unclear why and how these enzymes interact at the molecular/atomic level. Here, we solved the crystal structure of

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico