Saltar al contenido
Merck
Todas las fotos(6)

Documentos clave

HPA009682

Sigma-Aldrich

Anti-NDFIP1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinónimos:

Anti-Breast cancer-associated protein SGA-1M antibody produced in rabbit, Anti-NEDD4 WW domain-binding protein 5 antibody produced in rabbit, Anti-NEDD4 family-interacting protein 1 antibody produced in rabbit, Anti-Putative MAPK-activating protein PM13 antibody produced in rabbit, Anti-Putative NF-κ-B-activating protein 164 antibody produced in rabbit, Anti-Putative NFKB and MAPK-activating protein antibody produced in rabbit

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
Atlas de proteínas humanas número:
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Línea del producto

Prestige Antibodies® Powered by Atlas Antibodies

Formulario

buffered aqueous glycerol solution

reactividad de especies

human

técnicas

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:20-1:50

secuencia del inmunógeno

SRYQQLQNEEESGEPEQAAGDAPPPYSSISAESAAYFDYKDESGFPKP

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... NDFIP1(80762)

Categorías relacionadas

Descripción general

NDFIP1 (Nedd4 family interacting protein 1) is an adaptor protein belonging to the Nedd4 (neural precursor cell expressed developmentally down-regulated protein 4) protein family. It was originally identified in a Nedd4-binding protein screen. It resides in the Golgi and post-Golgi vesicles, and is composed of three transmembrane domains.

Inmunógeno

NEDD4 family-interacting protein 1 recombinant protein epitope signature tag (PrEST)

Aplicación

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Acciones bioquímicas o fisiológicas

NDFIP1 (Nedd4 family interacting protein 1) binds with membrane proteins and controls their interaction with cytoplasmic protein Nedd4 (neural precursor cell expressed developmentally down-regulated protein 4). In brain, it is co-expressed with Nedd4 in neurons, and during neuronal injury, their interaction is critical for promoting the survival of cortical neurons. It is neuroprotective, and in collaboration with Nedd4, ubiquitinates and removes harmful proteins, post brain-injury. It maintains iron homeostasis in cells by interacting with divalent metal transporter 1 (DMT1) and promoting its degradation. In brains of Parkinson′s disease (PD) patients, this protein is found to be expressed in astrocytes, where it is normally absent. Elevation in Parkinsonian brain iron levels leads to the up-regulation of NDFIP1 protein for the control of DMT1.

Características y beneficios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST71932

Forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 1

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Equipo de protección personal

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Johannes Routila et al.
BMC cancer, 21(1), 868-868 (2021-07-30)
Currently, no clinically useful biomarkers for radioresistance are available in head and neck squamous cell carcinoma (HNSCC). This study assesses the usefulness of Cell Line Microarray (CMA) method to enhance immunohistochemical screening of potential immunohistochemical biomarkers for radioresistance in HNSCC
Christine Schieber et al.
The Journal of biological chemistry, 286(10), 8555-8564 (2010-12-29)
The delivery of metal ions using cell membrane-permeable metal complexes represents a method for activating cellular pathways. Here, we report the synthesis and characterization of new [Co(III)(salen)(acac)] complexes capable of up-regulating the ubiquitin ligase adaptor protein Ndfip1. Ndfip1 is a
Jason Howitt et al.
Proceedings of the National Academy of Sciences of the United States of America, 106(36), 15489-15494 (2009-08-27)
The regulation of metal ion transport within neurons is critical for normal brain function. Of particular importance is the regulation of redox metals such as iron (Fe), where excess levels can contribute to oxidative stress and protein aggregation, leading to
Pilar López-Cotarelo et al.
Scientific reports, 11(1), 21371-21371 (2021-11-03)
One of the 233 polymorphisms associated with multiple sclerosis (MS) susceptibility lies within the NDFIP1 gene, and it was previously identified as eQTL in healthy controls. NDFIP1 shows interesting immune functions and is involved in the development of the central
Jian Xiong et al.
Cells, 12(1) (2023-01-09)
Glutamine is one of the most abundant amino acids in the cell. In mitochondria, glutaminases 1 and 2 (GLS1/2) hydrolyze glutamine to glutamate, which serves as the precursor of multiple metabolites. Here, we show that ammonium generated during GLS1/2-mediated glutaminolysis

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico