AV42196

Anti-ITGBL1 (AB1) antibody produced in rabbit

IgG fraction of antiserum

• Sinónimos: Anti-Integrin, β-like 1 (with EGF-like repeat domains), Anti-OSCP, Anti-TIED
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: IgG fraction of antiserum
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Formulario: buffered aqueous solution
• mol peso: 54 kDa
• reactividad de especies: horse, pig, dog, human
• concentración: 0.5 mg - 1 mg/mL
• técnicas: western blot: suitable
• Nº de acceso NCBI: NP_004782
• Nº de acceso UniProt: O95965
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... ITGBL1(9358)

Descripción

Descripción general

Integrin, β-like 1 (with EGF-like repeat domains) (ITGBL1, TIED) is a β integrin-related protein found in aorta, thymus and osteogenic sarcoma. Defects in ITGBL1 may be associated with isolated growth hormone deficiency.

Especificidad

Anti-ITGBL1 (AB1) polyclonal antibody reacts with canine, human, bovine, mouse, and rat integrin, β-like 1 (with EGF-like repeat domains) proteins.

Inmunógeno

Synthetic peptide directed towards the N terminal region of human ITGBL1

Aplicación

Anti-ITGBL1 (AB1) polyclonal antibody is used to tag integrin, β-like 1 (with EGF-like repeat domains) protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of integrin, β-like 1 (with EGF-like repeat domains) in cell processes such as isolated growth hormone deficiency

Secuencia

Synthetic peptide located within the following region: MRPPGFRNFLLLASSLLFAGLSAVPQSFSPSLRSWPGAACRLSRAESERR

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable