Skip to Content
Merck
All Photos(5)

Documents

MSST0001

Sigma-Aldrich

SILuProt APOA1, Apolipoprotein A-1 human

recombinant, expressed in HEK 293 cells, SIL MS Protein Standard, 13C- and 15N-labeled

Synonym(s):

SILuProt Apolipoprotein A-1

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
23201100
NACRES:
NA.12

biological source

human

Quality Level

recombinant

expressed in HEK 293 cells

tag

His tagged
V5 tagged

Assay

≥98% (SDS-PAGE)

form

lyophilized powder

packaging

vial of ≥10 μg (Lot-specific vial content given on certificate of analysis)

technique(s)

mass spectrometry (MS): suitable

UniProt accession no.

storage temp.

−20°C

Gene Information

human ... APOA1(335)

Related Categories

General description

ApoA-1 (apolipoprotein A-1) is a 29.0kDa protein produced in the liver and intestine, and secreted as the predominant constituent of nascent high-density lipoprotein (HDL) particle. BP- ApoA-1 (apolipoprotein A-1), which is found exclusively in HDL (high-density lipoprotein), has a unique ability to capture and solubilize free cholesterol. This apoA-1 ability enables HDL to remove excess peripheral cholesterol and return it to the liver for recycling and excretion. The therapeutic potential of apoA-1 has been recently assessed in patients with acute coronary syndromes, using a recombinant form of a naturally occurring variant of apoA-1 (called apoA-1 Milano). The availability of recombinant normal apoA-1 should facilitate further investigation into the potential usefulness of apoA-1 in preventing atherosclerotic vascular diseases. Changes in the level of serum apoA-1 may serve as a prognostic marker for non-metastatic nasopharyngeal carcinoma. Low levels of apoA-1 in the plasma are linked to hyperhomocysteinemia.

Physical form

Supplied as a lyophilized powder containing phosphate buffered saline.

Preparation Note

Briefly centrifuge the vial before opening. It is recommended to reconstitute the protein in sterile ultrapure water to a final concentration of 100μg/ml.

Storage and Stability

Store the lyophilized product at –20 oC. The product is stable for at least 2 years as supplied. After reconstitution, it is recommended to store the protein in working aliquots at –20 oC.

Analysis Note

General description

SILuProt ApoA−Ι is a recombinant, stable isotope-labeled human Apo A1 which incorporates [13C6, 15N4]-Arginine and [13C6, 15N2]-Lysine. Expressed in human 293 cells, it is designed to be used as an internal standard for bioanalysis of ApoA1 in mass-spectrometry. SILu Prot Apo A-Ι is a monomer of 280 amino acids (including C-terminal polyhistidine and V5 tags), with an apparent molecular weight of 32.3 kDa.

Sequence

RHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLK
LLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKV
QPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEM
RDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEK
AKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQSDPSRGPFEGK
PIPNPLLGLDSTRTGHHHHHHHHGGQ


The N-terminal signal peptide and C-terminal linker peptide, V5 and polyhistidine tags are italicized. Suggested transitions for three peptides (bolded) are used for selected reaction monitoring analysis (SRM).

Label Incorporation
≥ 98% as determined by mass spectrometry

Other Characterization
  • Sequence confirmed by intact mass analysis
  • Identity verified by peptide mapping
  • Purity >98% by SDS-PAGE
  • Vial content was determined by the Bradford method using BSA as a calibrator. The correction factor of Bradford-to-AAA is 88.33%

Suggested Quantitative Analysis Parameters
(MRM settings provided for three suggested peptides)

Legal Information

This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.
SILu is a trademark of Sigma-Aldrich Co. LLC

Storage Class Code

11 - Combustible Solids

WGK

WGK 2

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Hyperhomocysteinemia is associated with decreased apolipoprotein AI levels in normal healthy people.
Wang Y. et al.
BMC Cardiovascular Disorders, 16(1), 10-10 (2016)
Targeted inactivation of hepatic Abca1 causes profound hypoalphalipoproteinemia and kidney hypercatabolism of apoA-I.
Timmins J M, et al.
The Journal of Clinical Investigation, 115(5), 1333-1342 (2005)
Effect of recombinant ApoA-I Milano on coronary atherosclerosis in patients with acute coronary syndromes: a randomized controlled trial.
Nissen S E, et al.
JAMA : The Journal of the American Medical Association, 290(17), 2292-2300 (2003)
Serum apolipoprotein AI is a novel prognostic indicator for non-metastatic nasopharyngeal carcinoma.
Luo X, et al.
Oncotarget, 6(41), 44037-44037 (2015)
ABCA1 and ABCG1 synergize to mediate cholesterol export to apoA-I.
Gelissen I C, et al.
Arteriosclerosis, Thrombosis, and Vascular Biology, 26(3), 534-540 (2006)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service