Skip to Content
Merck
All Photos(1)

Documents

SAB2102716

Sigma-Aldrich

Anti-WT1 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Wt1 Antibody, Wt1 Antibody - Anti-WT1 antibody produced in rabbit, Anti-GUD, Anti-WAGR, Anti-WIT-2, Anti-WT33, Anti-Wilms tumor 1

Sign Into View Organizational & Contract Pricing


About This Item

MDL number:
UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

54 kDa

species reactivity

human

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... WT1(7490)

General description

Wilms tumor 1 (WT1) is a transcription factor with C-terminal zinc-finger motifs and an N-terminal proline/glutamine-rich DNA-binding domain. WT1 gene is mapped to human chromosome 11p13. WT1 expression occurs in the spleen, kidneys, gonads, and abdominal cavity lining during vertebrate development. WT1 exists as multiple transcript variants, resulting from alternative splicing at two coding exons. Evidence suggests the use of non-AUG (CUG) translation initiation site upstream of, and in-frame with the first AUG, leading to additional isoforms.

Immunogen

Synthetic peptide directed towards the N terminal region of human WT1

Application

Anti-WT1 antibody produced in rabbit has been used in western blotting.

Biochem/physiol Actions

Wilms tumor 1 (WT1) participates in the homeostasis of the adrenal glands and gonads. WT1 functions as an oncogene and its expression are observed in a majority of tumors associated with neuronal, hematopoietic, epithelial, and mesenchymal tissues. It serves as a target for cancer immune therapy. WT1 displays a tumor suppressor role in acute myeloid leukemia (AML). Mutations in the WT1 gene is also implicated in the pathophysiology of Denys-Drash syndrome (DDS) and Frasier syndrome (FS).

Sequence

Synthetic peptide located within the following region: PASQHTLRSGPGCLQQPEQQGVRDPGGIWAKLGAAEASAERLQGRRSRGA

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Min Hu et al.
Pediatric nephrology (Berlin, Germany), 19(10), 1160-1163 (2004-09-07)
We report a novel mutation in WT1 exon 9 (1214 A>G) resulting in an amino acid change from H to R at codon 405 in a 46 XY female patient who had congenital hypertrophic pyloric stenosis, pseudohermaphroditism masculinus, renal failure
L Yang et al.
Leukemia, 21(5), 868-876 (2007-03-16)
The Wilms' tumor 1 (WT1) gene encodes a transcription factor important for normal cellular development and cell survival. The initial discovery of WT1 as the causative gene in an autosomal-recessive condition identified it as a tumor suppressor gene whose mutations
Nicholas D Hastie
Development (Cambridge, England), 144(16), 2862-2872 (2017-08-16)
The study of genes mutated in human disease often leads to new insights into biology as well as disease mechanisms. One such gene is Wilms' tumour 1 (WT1), which plays multiple roles in development, tissue homeostasis and disease. In this
W Bruening et al.
The Journal of biological chemistry, 271(15), 8646-8654 (1996-04-12)
The Wilms' tumor (WT) suppressor gene, WT1, is mutated in a small set of WTs and is essential for proper development of the urogenital system. The gene has three sites of transcriptional initiation and produces mRNA transcripts containing 5'-untranslated regions
Aneta A Koronowicz et al.
PPAR research, 2017, 2865283-2865283 (2017-05-02)
In our previous study, we showed that fatty acids from CLA-enriched egg yolks (EFA-CLA) reduced the proliferation of breast cancer cells; however, the molecular mechanisms of their action remain unknown. In the current study, we used MCF-7 breast cancer cell

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service