MSST0029

SILu^™Prot APOA2 Apolipoprotein A-II human

recombinant, expressed in HEK 293 cells, SIL MS Protein Standard, ¹³C and ¹⁵N-labeled

• Synonym(s): Apo-AII, ApoA-II, ApolipoproteinA2
• UNSPSC Code: 23201100
• NACRES: NA.12

Properties

• biological source: human
• Quality Level: 200
• recombinant: expressed in HEK 293 cells
• tag: 8-His tagged
• Assay: ≥98% (SDS-PAGE)
• form: lyophilized powder
• potency: ≥98% Heavy amino acids incorporation efficiency by MS
• technique(s): mass spectrometry (MS): suitable
• suitability: suitable for mass spectrometry (standard)
• UniProt accession no.: P02652
• storage temp.: −20°C
• Gene Information: human ... APOA2(336)

Description

General description

Apolipoprotein A-II (ApoA-II) occurs in plasma as a dimer of two 77-amino acid chains linked by a disulfide bridge. After apoA-I, it is the second major protein component of HDL, accounting for approximately 20% of HDL total protein. ApoA-II is thought to play an important role in triglyceride metabolism both from animal and human studies. 3 Recent findings attribute apoA-II to inhibitory effects on lipoprotein lipase-mediated hydrolysis of triglyceride-rich particles. Additional associations of apoA-II have been reported for a variety of protein factors including hepatic lipase (HL), lipoprotein lipase (LPL), endothelial lipase, CETP, PLTP, and LCAT.

Immunogen

QAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQDYKDDDDKGHHHHHHHHGGQ

Biochem/physiol Actions

SILu^™ Prot APOA2 is a recombinant, stable isotope-labeled human APOA2 which incorporates [¹³C₆, ¹⁵N₄]-Arginine and [¹³C₆, ¹⁵N₄]-Lysine. Expressed in human 293 cells, it is designed to be used as an internal standard for bioanalysis of APOA2 in mass-spectrometry. SILu Prot APOA2 is a homodimer of 97 amino acids (including C-terminal polyhistidine and FLAG^® tags), with a calculated molecular mass of 11 kDa.

Physical form

Supplied as a lyophilized powder containing phosphate buffered saline.

Legal Information

This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.

FLAG is a registered trademark of Merck KGaA, Darmstadt, Germany

SILu is a trademark of Sigma-Aldrich Co. LLC

Safety Information

• Storage Class Code: 11 - Combustible Solids
• WGK: WGK 2
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable