Skip to Content
Merck
All Photos(3)

Key Documents

SAB1412447

Sigma-Aldrich

ANTI-HOXB7 antibody produced in mouse

clone 4C6, purified immunoglobulin, buffered aqueous solution

Synonym(s):

HHO.C1, HOX2, HOX2C, HOXB7, Hox-2.3

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

4C6, monoclonal

form

buffered aqueous solution

mol wt

antigen 33 kDa

species reactivity

human

technique(s)

immunohistochemistry: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG1κ

NCBI accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... HOXB7(3217)

General description

Homeobox B7 (HOXB7) is part of the HOX gene family and is expressed in embryonic tissues. The gene encoding it is localized on human chromosome 17q21.32.

Immunogen

HOXB7 (NP_004493, 55 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MQGLYPGGGGMAGQSAAGVYAAGYGLEPSSFNMHCAPFEQNLSGVCPGDSAKAAGAKEQRDSDLAA

Biochem/physiol Actions

Homeobox B7 (HOXB7) has a role in many cellular processes. It has been shown to be expressed in hepatocellular carcinoma. HOXB7 may also have a role in cell migration and invasion in gastric cancer. This transcription factor is vital for tissue differentiation and embryogenesis. HOXB7 may be a potential drug target in various cancers. The protein has the capacity to induce the expression of genes associated with tumor invasion and angiogenesis.

Physical form

Solution in phosphate buffered saline, pH 7.4

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

HOXB7-S3 inhibits the proliferation and invasion of MCF-7 human breast cancer cells.
Ma R
Molecular Medicine Reports, 12, 4901-4908 (2015)
Identification of several potential chromatin binding sites of HOXB7 and its downstream target genes in breast cancer.
Heinonen H
International Journal of Cancer. Journal International Du Cancer, 137, 2374-2383 (2015)
The roles of HOXB7 in promoting migration, invasion, and anti-apoptosis in gastric cancer.
Joo MK, et.al.
Journal of Gastroenterology and Hepatology, 31, 1717-1726 (2016)
Moon Kyung Joo et al.
Journal of gastroenterology and hepatology, 31(10), 1717-1726 (2016-10-30)
The aim of this study was to compare HOXB7 expression level between gastric cancer and non-cancerous gastric tissues. Additionally, the functional effects of HOXB7, including its pro-migration or invasion and anti-apoptosis roles, were evaluated in gastric cancer cells. Both gene
HOXB7 Expression is a Novel Biomarker for Long-term Prognosis After Resection of Hepatocellular Carcinoma.
Komatsu H
Anticancer Research, 36, 2767-2773 (2016)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service