Skip to Content
Merck
All Photos(4)

Key Documents

HPA014650

Sigma-Aldrich

Anti-TMED9 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-HSGP25L2G, Anti-p24a2, Anti-p24alpha2

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

rat, human

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50-1:200

immunogen sequence

GETEKKCFIEEIPDETMVIGNYRTQLYDKQREEYQPATPGLGMFVEVKDPEDKVILARQYGSEGRFTFTSHTPGEHQICLHS

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... TMED9(54732)

General description

TMED9 (transmembrane emp24 protein transport domain containing 9) belongs to a family of widely present, small, type I transmembrane proteins called p24 proteins. This family can be divided into four subfamilies namely, p23 or δ, p24 or β, p25 or α, and p26 or γ. TMED9 is also called p25 and is the only member of the p25 subfamily in mammals. It localizes to endoplasmic reticulum and cis-Golgi network (CGN). Its C-terminal is small and faces the cytoplasm and contains degenerate sorting motifs. It has a coiled-coil domain in its extracellular domain. It also contains a KKXX ER-retrieval motif.

Immunogen

transmembrane p24 trafficking protein 9

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

TMED9 (transmembrane emp24 protein transport domain containing 9) is thought to play a role in the formation of ER (endoplasmic reticulum) exit sites and vesicular tubular clusters (VTCs). It controls the dynamic and composition of membrane by forming highly-specialized domains. It also ensures that Golgi-membranes are low on cholesterol, to maintain normal membrane transport. This gene has an extremely high expression level in the pituitary of obese mice, and this expression is down-regulated when treated with leptin. TMED9 interacts with T-cell protein tyrosine phosphatase (TC48), and localizes it to the ER, where TC48 normally resides. TMED9 acts as a cargo receptor that shuttles between Golgi complex and the ER, and it also interacts with syntaxin 17. Syntaxin 17 is important for the maintenance of ERGIC (ER-Golgi intermediate compartment) and Golgi architecture.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST72987

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

TMED9 Expression Level as a Biomarker of Epithelial Ovarian Cancer Progression and Prognosis.
Han, et al.
Cancer, Genomics, and Proteomics, 19, 692-702 (2022)
Gregory Emery et al.
Journal of cell science, 116(Pt 23), 4821-4832 (2003-11-06)
Trans-membrane proteins of the p24 family are abundant, oligomeric proteins predominantly found in cis-Golgi membranes. They are not easily studied in vivo and their functions are controversial. We found that p25 can be targeted to the plasma membrane after inactivation
Vijay Gupta et al.
Journal of cell science, 119(Pt 9), 1703-1714 (2006-04-06)
T-cell protein tyrosine phosphatase gives rise to two splice isoforms: TC48, which is localized to the endoplasmic reticulum (ER) and TC45, a nuclear protein. The present study was undertaken to identify proteins that are involved in targeting TC48 to the
Madhavi Muppirala et al.
Biochimica et biophysica acta, 1823(12), 2109-2119 (2012-09-26)
The T-cell protein tyrosine phosphatase is expressed as two splice variants - TC45, a nuclear protein, and TC48, which is localized predominantly in the ER (endoplasmic reticulum). Yeast two-hybrid screening revealed direct interaction of TC48 with Syntaxin17, a SNARE (soluble
G Emery et al.
Journal of cell science, 113 ( Pt 13), 2507-2516 (2000-06-15)
Recent studies show that small trans-membrane proteins of approximately 22-24 kDa (the p24 family), which are grouped into 4 sub-families by sequence homology (p23, p24, p25 and p26), are involved in the early secretory pathway. In this study, we have

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service