Skip to Content
Merck
All Photos(2)

Key Documents

AV40397

Sigma-Aldrich

Anti-NOVA1 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-Neuro-oncological ventral antigen 1, Anti-Nova-1

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

52 kDa

species reactivity

dog, human, rabbit, mouse, horse, guinea pig, rat, bovine

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... NOVA1(4857)

General description

NOVA1 (Neuro-oncological ventral antigen 1) is a neuron-specific nuclear RNA-binding protein expressed in brain, specifically in hippocampus, hypothalamus, cingulate cortex, and medial habenular nucleus.

Immunogen

Synthetic peptide directed towards the C terminal region of human NOVA1

Application

Anti-NOVA1 antibody produced in rabbit is suitable for western blot analysis.

Biochem/physiol Actions

NOVA1 (Neuro-oncological ventral antigen 1) is associated with several post-transcriptional regulation of RNA metabolism including RNA splicing, editing to transport, localization, and degradation. It may be involved in mediating neuronal responsiveness. It encodes a protein which has homology with the RNA-binding protein hnRNP K, the yeast splicing protein MER1. Since, it has some homology with hnRNP K, it may influence the regulation of RNA splicing or metabolism in developing neurons. The importance of NOVA1 as prognostic marker has been reported in HCC (Hepatocellular carcinoma). Alteration in gene causes a disorder associated with breast cancer and motor dysfunction i.e. paraneoplastic opsoclonus myoclonus ataxia (POMA).

Sequence

Synthetic peptide located within the following region: SKKGEFVPGTRNRKVTITGTPAATQAAQYLITQRITYEQGVRAANPQKVG

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

R J Buckanovich et al.
Neuron, 11(4), 657-672 (1993-10-01)
Paraneoplastic opsoclonus-ataxia, a disorder of motor control, develops in breast or lung cancer patients who harbor an antibody (Ri) that recognizes their tumors and a nuclear neuronal protein of 55 kd. We have characterized a gene, Nova, encoding an antigen
Yi-An Zhang et al.
PloS one, 9(3), e90955-e90955 (2014-03-13)
Neuro-oncological ventral antigen 1 (Nova1) is a neuron-specific RNA-binding protein in human paraneoplastic opsoclonus-myoclonus ataxia accompanying with malignant tumors, but its role in hepatocellular carcinoma (HCC) remains elusive. In this study, we found that overexpressed intratumoral Nova1 was associated with
R J Buckanovich et al.
Molecular and cellular biology, 17(6), 3194-3201 (1997-06-01)
Nova-1, an autoantigen in paraneoplastic opsoclonus myoclonus ataxia (POMA), a disorder associated with breast cancer and motor dysfunction, is a neuron-specific nuclear RNA binding protein. We have identified in vivo Nova-1 RNA ligands by combining affinity-elution-based RNA selection with protein-RNA
Hualing Li et al.
The journal of histochemistry and cytochemistry : official journal of the Histochemistry Society, 61(1), 45-54 (2012-10-09)
The present study aimed to evaluate the expression of neuro-oncological ventral antigen 1 (Nova1) in cerebral ischemia/reperfusion (I/R) insults by immunohistochemistry. The focal cerebral I/R model was induced by right middle cerebral artery occlusion (MCAO) for 120 min followed by

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service