AV34548

Anti-TRIM17 (AB2) antibody produced in rabbit

IgG fraction of antiserum

• Synonym(s): Anti-Tripartite motif-containing 17
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: IgG fraction of antiserum
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 54 kDa
• species reactivity: human
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_001020111
• UniProt accession no.: Q9Y577
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... TRIM17(51127)

Description

General description

TRIM17 (Terf) is an E3 ubiquitin ligase that mediates Mcl-1 degradation and initiates apoptosis in neurons. Terf can also facilitate the degradation of ZWINT (a kinetochore protein) and decrease the proliferation of MCF7 breast cancer cells.
Rabbit Anti-TRIM17 antibody recognizes human TRIM17.

Immunogen

Synthetic peptide directed towards the C terminal region of human TRIM17

Application

Rabbit Anti-TRIM17 (AB2) antibody is suitable for western blot applications at a concentration of 1.25 μg/ml.

Biochem/physiol Actions

TRIM17 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. The protein is expressed almost exclusively in the testis, but its function is unknown. Multiple alternatively spliced transcript variants have been found for this gene.

Sequence

Synthetic peptide located within the following region: PKCPENGFWVVQLSKGTKYLSTFSALTPVMLMEPPSHMGIFLDFEAGEVS

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable