Skip to Content
Merck
All Photos(8)

Key Documents

WH0002027M1

Sigma-Aldrich

Monoclonal Anti-ENO3 antibody produced in mouse

clone 5D1, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-MSE, Anti-enolase 3 (beta, muscle)

Sign Into View Organizational & Contract Pricing


About This Item

MDL number:
UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

5D1, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

Gene Information

human ... ENO3(2027)

General description

ENO3 (enolase 3) gene codes for enolase enzyme. This isoenzyme is present in skeletal and cardiac muscle cells. This gene is located on human chromosome 17pter-p11 b.
This gene encodes one of the three enolase isoenzymes found in mammals. This isoenzyme, a homodimer, is found in skeletal muscle cells in the adult. A switch from alpha enolase to beta enolase occurs in muscle tissue during development in rodents. Mutations in this gene can be associated with metabolic myopathies that may result from decreased stability of the enzyme. Two transcripts have been identified for this gene that differ only in their 5′ UTR. (provided by RefSeq)

Immunogen

ENO3 (NP_001967, 228 a.a. ~ 277 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
KTAIQAAGYPDKVVIGMDVAASEFYRNGKYDLDFKSPDDPARHITGEKLG

Biochem/physiol Actions

Mutations in ENO3 (enolase 3) is linked with metabolic myopathies that may occur due to decreased stability of the enzyme. It catalyses the interconversion of 2-phosphoglycerate and phosphoenolpyruvate. ENO3 possess several methylation properties.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

12 - Non Combustible Liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Gene expression profile of rat left ventricles reveals persisting changes following chronic mild exercise protocol: implications for cardioprotection
Giusti B, et al.
BMC Genomics (2009)
The implications of human metabolic network topology for disease comorbidity
Lee DS, et al.
Proceedings of the National Academy of Sciences of the USA, 105(29), 9880-9885 (2008)
Characterization of porcine ENO3: genomic and cDNA structure, polymorphism and expression
Wu J, et al.
Genetics, Selection, Evolution : GSE, 40(5), 563-579 (2008)
Methylation patterns in the human muscle-specific enolase gene (ENO3)
Peshavaria M and Day IN
The Biochemical Journal (1993)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service