SAB1403429

Monoclonal Anti-ACRC, (C-terminal) antibody produced in mouse

clone 2E4, purified immunoglobulin, buffered aqueous solution

• Synonym(s): NAAR1
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 2E4, monoclonal
• form: buffered aqueous solution
• mol wt: antigen ~37.11 kDa
• species reactivity: human
• technique(s): capture ELISA: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG2aκ
• NCBI accession no.: NM_052957
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... ACRC(93953)

Description

General description

The gene ACRC (acidic repeat containing) is mapped to human chromosome Xq13.1 and contains at least 12 exons and 11 introns. It contains a characteristic acidic repeat region of 21 units of 8–10 amino acids. It is expressed ubiquitously, including skeletal muscle, liver, kidney, pancreas, heart, lung, and brain, with the highest expression in skeletal muscle.

Immunogen

ACRC (NP_443189.1, 592 a.a. ~ 691 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
HEMCHAASWLIDGIHDSHGDAWKYYARKSNRIHPELPRVTRCHNYKINYKVHYECTGCKTRIGCYTKSLDTSRFICAKCKGSLVMVPLTQKDGTRIVPHV

Biochem/physiol Actions

The gene ACRC (acidic repeat containing) is localized on a critical region that harbors the disease locus for X-linked dystonia parkinsonism (XDP). However, mutation analysis in this gene does not implicate it in the disease.

Physical form

Solution in phosphate buffered saline, pH 7.4

Safety Information

• Storage Class Code: 13 - Non Combustible Solids
• WGK: WGK 1
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable