Skip to Content
Merck
All Photos(1)

Key Documents

MSST0039

Sigma-Aldrich

SILuProt IFNG Interferon Gamma human

recombinant, expressed in HEK 293 cells, SIL MS Protein Standard, 13C and 15N-labeled

Synonym(s):

IFNγ, IFN-gamma, IFNG mass-spectrometry standard, Immune interferon, Immuneinterferon, Interferon-gamma mass-spectrometry standard, stable isotope-labeled human IFNG

Sign Into View Organizational & Contract Pricing

Select a Size

10 μG
$1,060.00

$1,060.00


Estimated to ship on02 May 2025Details

New, lower price on this item!

Request a Bulk Order

Select a Size

Change View
10 μG
$1,060.00

About This Item

UNSPSC Code:
23201100
NACRES:
NA.12

$1,060.00


Estimated to ship on02 May 2025Details

New, lower price on this item!

Request a Bulk Order

biological source

human

Quality Level

recombinant

expressed in HEK 293 cells

Assay

≥98% (SDS-PAGE)

form

lyophilized powder

potency

≥98% Heavy amino acids incorporation efficiency by MS

mol wt

calculated mol wt 17 kDa

technique(s)

mass spectrometry (MS): suitable

suitability

suitable for mass spectrometry (standard)

UniProt accession no.

storage temp.

−20°C

Gene Information

human ... IFNG(3458)

General description

Interferon gamma (IFNγ) is a dimerized soluble cytokine that is the only member of the type II class of interferons. IFNγ is secreted by T helper cells (specifically, Th1 cells), cytotoxic T cells (TC cells) and Natural killer (NK) cells. When combined with other inflammatory cytokines, evaluating the levels of IFNγ can be used as a diagnostic tool in patients with breast cancer or benign prostatic hyperplasia. A recent study evaluated the effect of a cancer vaccine given to patients with colorectal cancer, on the levels of plasma pro-inflammatory cytokines (including IFN-γ). The study concluded that patients achieving stable disease showed increasing levels of plasma inflammatory cytokines.

Immunogen

QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRG

Biochem/physiol Actions

SILuProt IFNG is a recombinant, stable isotope-labeled human IFNG which incorporates [13C6, 15N4]-Arginine and [13C6, 15N2]-Lysine. Expressed in human 293 cells, it is designed to be used as an internal standard for bioanalysis of IFNG in mass-spectrometry. SILu Prot IFNG is a homodimer consisting of 138 amino acids, with a calculated molecular mass of 17 kDa.

Physical form

Supplied as a lyophilized powder containing phosphate buffered saline.

Legal Information

This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), [email protected].
SILu is a trademark of Sigma-Aldrich Co. LLC

Storage Class Code

11 - Combustible Solids

WGK

WGK 2

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service