Skip to Content
Merck
All Photos(5)

Documents

HPA011133

Sigma-Aldrich

Anti-LPP antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-LIM domain-containing preferred translocation partner in lipoma, Anti-Lipoma-preferred partner

Sign Into View Organizational & Contract Pricing


About This Item

MDL number:
UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

independent
orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

immunogen sequence

PSPHYMAAPSSGQIYGSGPQGYNTQPVPVSGQCPPPSTRGGMDYAYIPPPGLQPEPGYGYAPNQGRYYEGYYAAGPGYGGRNDSDPTYGQQGHPNTWKREPGY

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... LPP(4026)

General description

LPP (LIM domain containing preferred translocation partner in lipoma) is a member of group 3 of LIM (Lin11, Isl-1 & Mec-3) family of proteins. It is localized to human chromosome 3q28, has 10 exons, and spans around 400kb. It has an open reading frame of 1836bp, which codes for an 80kDa protein. Its N-terminal contains a leucine zipper motif, and it has three LIM domains at its C-terminal. It is expressed by the smooth muscle cells of stomach, portal vein, aorta, bladder, ileum, corpus cavernosum and uterus. Two alternatively spliced variants are exclusively expressed in testis.

Immunogen

Lipoma-preferred partner recombinant protein epitope signature tag (PrEST)

Application

Anti-LPP antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem/physiol Actions

LPP (LIM domain containing preferred translocation partner in lipoma) is involved in cell-cell adhesion and cell locomotion, as in the case of epithelial cells of small intestine. Therefore, it might be implicated in the pathogenesis of celiac disease. It interacts with protein-tyrosine-phosphatase 1 B (PTP1B), and thus, might be involved in insulin signaling pathway. It is therefore, a candidate gene for polycystic ovary syndrome (PCOS). It is up-regulated in many human cancers such as, lung carcinoma, soft tissue sarcoma, and leukemia. It is a translocation partner of chromosome 12, in a subset of lipomas. LPP plays a role in cell proliferation and tumorigenesis. It amplifies the transactivational activity of PEA3 (polyoma enhancer activator 3), by acting as a co-regulatory protein at PEA3-dependent promoters.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST72480

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Rodrigo Almeida et al.
Human molecular genetics, 23(9), 2481-2489 (2013-12-18)
Using the Immunochip for genotyping, we identified 39 non-human leukocyte antigen (non-HLA) loci associated to celiac disease (CeD), an immune-mediated disease with a worldwide frequency of ∼1%. The most significant non-HLA signal mapped to the intronic region of 70 kb
M M Petit et al.
Genomics, 36(1), 118-129 (1996-08-15)
A major cytogenetic subgroup of lipomas is characterized by recurrent chromosome aberrations, mainly translocations, that involve chromosome segment 12q13-q15. Multiple chromosomes have been found as the translocation partners of chromosome 12 but 3q27-q28 is preferentially involved. In previous studies, it
Subhajit Ghosh et al.
Journal of the American Heart Association, 4(6), e001712-e001712 (2015-06-14)
Exposure of vascular smooth muscle cells (VSMCs) to excessive cyclic stretch such as in hypertension causes a shift in their phenotype. The focal adhesion protein zyxin can transduce such biomechanical stimuli to the nucleus of both endothelial cells and VSMCs
Bo Zhang et al.
PloS one, 7(10), e46370-e46370 (2012-10-12)
Previous genome-wide association study (GWAS) of polycystic ovary syndrome (PCOS) in Han Chinese population has found that SNPs in LPP gene were nominally significant in PCOS patients (P around 10E-05). Replication of the GWAS was applied to further confirm the
Thomas Gp Grunewald et al.
Translational oncology, 2(3), 107-116 (2009-08-25)
Integrating signals from the extracellular matrix through the cell surface into the nucleus is an essential feature of metazoan life. To date, many signal transducers known as shuttle proteins have been identified to act as both a cytoskeletal and a

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service