Skip to Content
Merck
All Photos(1)

Key Documents

AV48425

Sigma-Aldrich

Anti-NUDCD1 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-CML66, Anti-FLJ14991, Anti-NudC domain containing 1

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

67 kDa

species reactivity

human, horse, mouse, rat, guinea pig, rabbit, dog

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... NUDCD1(84955)

General description

NUDCD1 (CML66) codes for an NUDCD1 domain containing protein that is expressed in the cytoplasm. This protein is mainly expressed in the testis and solid tumors. Studies have reported that it is an immunogenic tumor antigen which is associated with chronic myelogenous leukemia.
Rabbit Anti-NUDCD1 antibody recognizes canine, chicken, human, mouse, rat, and bovine NUDCD1.

Immunogen

Synthetic peptide directed towards the N terminal region of human NUDCD1

Application

Rabbit Anti-NUDCD1 antibody is suitable for western blot applications at a concentration of 1μg/ml.

Biochem/physiol Actions

NUDCD1 (CML66) contains 1 CS domain. It may play an oncogenic role in ways of favoring tumor cells proliferation, invasion and metastasis-associated with multiple pathways.

Sequence

Synthetic peptide located within the following region: EVAANCSLRVKRPLLDPRFEGYKLSLEPLPCYQLELDAAVAEVKLRDDQY

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Yan Yan et al.
Journal of immunology (Baltimore, Md. : 1950), 172(1), 651-660 (2003-12-23)
This report describes the difference in the epitope generation of two isoforms of self-tumor Ag CML66 and the regulation mechanism. We identified a new CML66 short isoform, termed CML66-S. The previously identified long CML66 is referred to as CML66-L. CML66-S
X F Yang et al.
Proceedings of the National Academy of Sciences of the United States of America, 98(13), 7492-7497 (2001-06-21)
This report describes a tumor-associated antigen, termed CML66, initially cloned from a chronic myelogenous leukemia (CML) cDNA expression library. CML66 encodes a 583-aa protein with a molecular mass of 66 kDa and no significant homology to other known genes. CML66

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service