Synthetic peptide directed towards the C terminal region of human TEAD3
Biochem/physiol Actions
TEAD3 is a member of the transcriptional enhancer factor (TEF) family. The family members contain the TEA/ATTS DNA-binding domain. This member is preferentially expressed in placenta and transactivates the chorionic somatomammotropin gene enhancer.This gene encodes a member of the transcriptional enhancer factor (TEF) family. The family members contain the TEA/ATTS DNA-binding domain. This member is preferentially expressed in placenta and transactivates the chorionic somatomammotropin gene enhancer. The protein is encoded through the use of a non-AUG (ATA) translation initiation codon.This gene encodes a member of the transcriptional enhancer factor (TEF) family. The family members contain the TEA/ATTS DNA-binding domain. This member is preferentially expressed in placenta and transactivates the chorionic somatomammotropin gene enhancer. The protein is encoded through the use of a non-AUG (ATA) translation initiation codon.
Sequence
Synthetic peptide located within the following region: MMNSVLENFTILQVVTSRDSQETLLVIAFVFEVSTSEHGAQHHVYKLVKD
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
TEA domain (TEAD) transcription factors are key components of the Hippo-YAP1 signaling pathway, but their functional role and regulatory mechanisms remain unclear. This study aims to comprehensively explore the expression pattern and functional role of TEAD family in gastric carcinogenesis
Questions
Reviews
★★★★★ No rating value
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.