APREST94005
PrEST Antigen SLC22A6
Prestige Antigens Powered by Atlas Antibodies, buffered aqueous solution
Sign Into View Organizational & Contract Pricing
All Photos(1)
About This Item
recombinant
expressed in E. coli
Assay
>80% (SDS-PAGE)
form
buffered aqueous solution
mol wt
predicted mol wt 22 kDa
purified by
immobilized metal affinity chromatography (IMAC)
concentration
≥0.5 mg/mL
immunogen sequence
PTQKEAGIYPRKGKQTRQQQEHQKYMVPLQASAQ
Ensembl | human accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
Gene Information
human ... SLC22A6(9356)
General description
Recombinant protein fragment of Human SLC22A6 with N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.
Application
Blocking agent and positive assay control using corresponding antibodies.
Linkage
Corresponding Antibody HPA074559.
Physical form
Solution in phosphate-buffered saline and 1M Urea, pH 7.4
Preparation Note
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Storage Class Code
10 - Combustible liquids
WGK
WGK 2
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service