Skip to Content
Merck
All Photos(6)

Key Documents

WH0253260M1

Sigma-Aldrich

Monoclonal Anti-RICTOR antibody produced in mouse

clone 1F3, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-DKFZp686B11164, Anti-KIAA1999, Anti-MGC39830, Anti-mAVO3, Anti-rapamycin-insensitive companion of mTOR

Sign Into View Organizational & Contract Pricing

Select a Size

100 μG
5 070,00 kr

5 070,00 kr


Please contact Customer Service for Availability


Select a Size

Change View
100 μG
5 070,00 kr

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

5 070,00 kr


Please contact Customer Service for Availability

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

1F3, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
immunoprecipitation (IP): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2bκ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... RICTOR(253260)

General description

RICTOR and MTOR (FRAP1; MIM 601231) are components of a protein complex that integrates nutrient- and growth factor-derived signals to regulate cell growth (Sarbassov et al., 2004 [PubMed 15268862]).[supplied by OMIM

Immunogen

RICTOR (NP_689969, 1 a.a. ~ 98 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MAAIGRGRSLKNLRVRGRNDSGEENVPLDLTREPSDNLREILQNVARLQGVSNMRKLGHLNNFTKLLCDIGHSEEKLGFHYEDIIICLRLALLNEAKE

Biochem/physiol Actions

RPTOR independent companion of MTOR complex 2 (RICTOR) maintains stability of the mechanistic target of rapamycin (mTOR) complex 2.[1] It also has a role in neutrophil chemotaxis and has been linked to prostate cancer.[2]

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

nwg

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Akechai Im-aram et al.
PloS one, 8(9), e75455-e75455 (2013-10-03)
Resistance to cisplatin-based therapy is a major cause of treatment failure in human ovarian cancer. A better understanding of the mechanisms of cisplatin resistance will offer new insights for novel therapeutic strategies for this deadly disease. Akt and p53 are
Shan-Yun Wen et al.
International journal of clinical and experimental pathology, 7(5), 2068-2078 (2014-06-27)
Early-stage endometrial carcinoma (EC) patients have a high cure rate; however, those with high-risk factors may have poor prognosis. Thus, there is an urgent need for searching for new prognostic molecules to more accurately predict survival of patients. We detected
Yuhai Bian et al.
Biochemical and biophysical research communications, 464(2), 534-540 (2015-07-15)
The rapamycin insensitive companion of mTOR (Rictor) is an essential subunit of mTOR complex 2 (mTORC2), maintains the integrity of the complex and functions as regulator of Akt full activation. Rictor has been implicated to be involved in growth and

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service