WH0079092M1

Monoclonal Anti-CARD14 antibody produced in mouse

clone 4B3, purified immunoglobulin, buffered aqueous solution

• Synonym(s): Anti-BIMP2, Anti-CARMA2, Anti-caspase recruitment domain family, member 14
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 4B3, monoclonal
• form: buffered aqueous solution
• species reactivity: human
• technique(s): indirect ELISA: suitable
• isotype: IgG2bκ
• GenBank accession no.: NM_024110
• UniProt accession no.: Q9BXL6
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... CARD14(79092)

Description

General description

The protein encoded by this gene belongs to the membrane-associated guanylate kinase (MAGUK) family, a class of proteins that functions as molecular scaffolds for the assembly of multiprotein complexes at specialized regions of the plasma membrane. This protein is also a member of the CARD protein family, which is defined by carrying a characteristic caspase-associated recruitment domain (CARD). This protein shares a similar domain structure with CARD11 protein. The CARD domains of both proteins have been shown to specifically interact with BCL10, a protein known to function as a positive regulator of cell apoptosis and NF-kappaB activation. When expressed in cells, this protein activated NF-kappaB and induced the phosphorylation of BCL10. Two alternatively spliced variants of this gene encoding distinct isoforms have been reported. (provided by RefSeq)

Immunogen

CARD14 (NP_077015, 905 a.a. ~ 1004 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
VQLDSVCTLHRMDIFPIVIHVSVNEKMAKKLKKGLQRLGTSEEQLLEAARQEEGDLDRAPCLYSSLAPDGWSDLDGLLSCVRQAIADEQKKVVWTEQSPR

Biochem/physiol Actions

The gene CARD14 (caspase recruitment domain family member 14) encodes a nuclear factor that contains a CARD domain involved in binding to the CARD domain of BCL10 (B cell leukemia 10), a protein involved in the activation of NF-κB through the IKK complex, and positive regulation of apoptosis. Mutations in this gene are associated with familial pityriasis rubra pilaris, a papulosquamous disorder phenotypically related to psoriasis. It also activates p38 and JNK MAP (c-Jun N-terminal kinase mitogen-activated protein) kinase pathways via association with paracaspase-1 (PCASP-1), also referred to as MALT1, which can serve as a therapeutic target in psoriasis.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: nwg
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable
• Personal Protective Equipment: dust mask type N95 (US), Eyeshields, Gloves