Skip to Content
Merck
All Photos(3)

Key Documents

WH0002801M1

Sigma-Aldrich

Monoclonal Anti-GOLGA2 antibody produced in mouse

clone 2C6, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-GM130, Anti-MGC20672, Anti-golgi autoantigen, golgin subfamily a, 2

Sign Into View Organizational & Contract Pricing

Select a Size

100 μG
5 070,00 kr

5 070,00 kr


Please contact Customer Service for Availability
A recombinant, preservative-free antibody is available for your target. Try ZRB1513


Select a Size

Change View
100 μG
5 070,00 kr

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

5 070,00 kr


Please contact Customer Service for Availability
A recombinant, preservative-free antibody is available for your target. Try ZRB1513

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

2C6, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG1κ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... GOLGA2(2801)

General description

The Golgi apparatus, which participates in glycosylation and transport of proteins and lipids in the secretory pathway, consists of a series of stacked cisternae (flattened membrane sacs). Interactions between the Golgi and microtubules are thought to be important for the reorganization of the Golgi after it fragments during mitosis. The golgins are a family of proteins, of which the protein encoded by this gene is a member, that are localized to the Golgi. This encoded protein has been postulated to play roles in the stacking of Golgi cisternae and in vesicular transport. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of these variants has not been determined. (provided by RefSeq)

Immunogen

GOLGA2 (AAH06381.1, 1 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
EQAEARRQILETMQNDRTTISRALSQNRELKEQLAELQSGFVKLTNENMEITSALQSEQHVKRELGKKLGELQEKLSELKETVELKSQEAQSLQQQRDQYLGHLQQYVAAYQQLTSEKEV

Biochem/physiol Actions

GOLGA2 (Golgin subfamily A member 2) is highly involved in the maintenance of Golgi structure. The proper maintenance of Golgi structure requires specific lateral cisternal-fusion events. During mitosis, GOLGA2 helps to reorganize Golgi ribbons at a stable structure by proper distribution of enzymes in the Golgi apparatus. It has been reported that GOLGA2 participates in centrosome-associated nucleating activity in association with AKAP450 to extend the Golgi. It also participates in endoplasmic reticulum-to-Golgi transport and mitotic Golgi apparatus fragmentation. It interacts with and stabilizes GRASP65 (Golgi peripheral membrane protein p65).

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Nobuhiro Nakamura
Journal of pharmacological sciences, 112(3), 255-264 (2010-03-04)
GM130 is a peripheral membrane protein strongly attached to the Golgi membrane and is isolated from the detergent and salt resistant Golgi matrix. GM130 is rich in coiled-coil structures and predicted to take a rod-like shape. Together with p115, giantin
Sabrina Rivero et al.
The EMBO journal, 28(8), 1016-1028 (2009-02-27)
We report that microtubule (MT) nucleation at the Golgi apparatus requires AKAP450, a centrosomal gamma-TuRC-interacting protein that also forms a distinct network associated with the Golgi. Depletion of AKAP450 abolished MT nucleation at the Golgi, whereas depletion of the cis-Golgi
Manojkumar A Puthenveedu et al.
Nature cell biology, 8(3), 238-248 (2006-02-21)
The mammalian Golgi apparatus exists as stacks of cisternae that are laterally linked to form a continuous membrane ribbon, but neither the molecular requirements for, nor the purpose of, Golgi ribbon formation are known. Here, we demonstrate that ribbon formation

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service