Skip to Content
Merck
All Photos(4)

Key Documents

WH0001513M1

Sigma-Aldrich

Monoclonal Anti-CTSK antibody produced in mouse

clone 2F1, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-CTS02, Anti-CTSO, Anti-CTSO1, Anti-CTSO2, Anti-MGC23107, Anti-PKND, Anti-PYCD, Anti-cathepsin K (pycnodysostosis)

Sign Into View Organizational & Contract Pricing

Select a Size

100 μG
4 310,00 kr

4 310,00 kr


Please contact Customer Service for Availability


Select a Size

Change View
100 μG
4 310,00 kr

About This Item

MDL number:
UNSPSC Code:
12352203
NACRES:
NA.41

4 310,00 kr


Please contact Customer Service for Availability

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

2F1, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... CTSK(1513)

General description

The protein encoded by this gene is a lysosomal cysteine proteinase involved in bone remodeling and resorption. This protein, which is a member of the peptidase C1 protein family, is predominantly expressed in osteoclasts. However, the encoded protein is also expressed in a significant fraction of human breast cancers, where it could contribute to tumor invasiveness. Mutations in this gene are the cause of pycnodysostosis, an autosomal recessive disease characterized by osteosclerosis and short stature. This gene may be subject to RNA editing. (provided by RefSeq)

Immunogen

CTSK (AAH16058, 220 a.a. ~ 329 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
KCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM

Biochem/physiol Actions

Cathepsin K has a role in bone resorption and remodeling. It has a triple helical collagen hydrolase activity. Mutations in the gene encoding this protein have been linked to pycnodysostosis.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Joaquín Bobillo Lobato et al.
Medicina clinica, 145(7), 281-287 (2015-02-11)
Gaucher disease is an inherited disorder caused by deficit of acid β-glucocerebrosidase, responsible for the degradation of glucosylceramide to ceramide and glucose. Although the disorder is primarily hematologic, bone is the second most commonly affected structure. Cathepsin K (CATK) is
Xianglan Huang et al.
Calcified tissue international, 96(5), 373-378 (2015-03-03)
Pycnodysostosis is a rare autosomal recessive skeletal dysplasia characterized by short stature, osteosclerosis, acro-osteolysis, frequent fractures, and skull deformities. Mutation in the gene encoding cathepsin K (CTSK), which is a lysosomal cysteine protease, has been found to be responsible for
M S McQueney et al.
The Journal of biological chemistry, 272(21), 13955-13960 (1997-05-23)
The in vitro activation of the recombinant purified human cathepsin K (EC 3.4.22.38) was examined by mutagenesis. Cathepsin K was expressed as a secreted proenzyme using baculovirus-infected Sf21 insect cells. Spontaneous in vitro activation of procathepsin K occurred at pH
Adeleke H Aguda et al.
Proceedings of the National Academy of Sciences of the United States of America, 111(49), 17474-17479 (2014-11-26)
Cathepsin K is the major collagenolytic protease in bone that facilitates physiological as well as pathological bone degradation. Despite its key role in bone remodeling and for being a highly sought-after drug target for the treatment of osteoporosis, the mechanism

Questions

  1. The antibody is in a buffered aqueous solution and one vial is 100ug, but what is the concentration and volume?

    1 answer
    1. The concentration of this antibody is typically 0.5 mg/mL. The lot specific value is reported in the Certificate of Analysis. Please see the link below to review a sample or lot specific Certificate:
      https://www.sigmaaldrich.com/product/sigma/wh0001513m1#product-documentation

      Helpful?

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service