Skip to Content
Merck
All Photos(2)

Key Documents

SAB2109073

Sigma-Aldrich

Anti-USP30 antibody produced in rabbit

Anti-USP30 antibody produced in rabbit
1 of 1 reviewers received a sample product or took part in a promotion

affinity isolated antibody

Synonym(s):

FLJ40511, MGC10702

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
3 870,00 kr

3 870,00 kr


Please contact Customer Service for Availability


Select a Size

Change View
100 μL
3 870,00 kr

About This Item

UNSPSC Code:
12352203
NACRES:
NA.43

3 870,00 kr


Please contact Customer Service for Availability

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

57 kDa

species reactivity (predicted by homology)

canine, rabbit, horse, human, bovine, rat, guinea pig, mouse

concentration

0.5 mg/mL

technique(s)

western blot: 1 μg/mL

NCBI accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... USP30(57396)

General description

USP30, a member of the ubiquitin-specific protease family (see USP1, MIM 603478), is a novel mitochondrial deubiquitinating (DUB) enzyme (Nakamura and Hirose, 2008 [PubMed 18287522]).

Immunogen

Synthetic peptide directed towards the middle region of human USP30

Sequence

Synthetic peptide located within the following region: SCLLDVLRMYRWQISSFEEQDAHELFHVITSSLEDERDRQPRVTHLFDVH

Physical form

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

nwg

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

It looks like we've run into a problem, but you can still download Certificates of Analysis from our Documents section.

If you need assistance, please contact Customer Support.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Questions

Reviews

1 of 1 reviewers received a sample product or took part in a promotion

Active Filters

  1. Pennsylvania
    • Review 1
    • Vote 1
    1 out of 5 stars.

    This antibody does not work

    We tested this antibody using 1 ug/ml and 2 ug/ml concentration in western blot and it did not work for protein extracted from human cells (HepG2), mouse cells (AML12) and male & female C57BL/6 mice liver. We used GAPDH as loading control and it worked perfectly, giving clear bands in those samples. However, no band was detected for USP30 using this antibody even at 2 ug/ml i.e 1:250 dilution of the antibody. This is a complete waste of money and the product should have been well validated before sale.

    Helpful?

    1. Response from MilliporeSigma:

      Thank you for taking the time to leave a review! We are sorry to hear that your experience did not meet expectations. We would like to learn more about your experience to see if there is anything we can do to help troubleshoot this issue. When you have a moment, please contact us by visiting https://www.sigmaaldrich.com/support/customer-support and submit a Report Product Issue ticket. We look forward to hearing from you soon!

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service