Skip to Content
Merck
All Photos(1)

Key Documents

SAB1405974

Sigma-Aldrich

Anti-HTN1 antibody produced in mouse

purified immunoglobulin, buffered aqueous solution

Synonym(s):

HIS1

Sign Into View Organizational & Contract Pricing

Select a Size

50 μG
3 800,00 kr

3 800,00 kr


Please contact Customer Service for Availability


Select a Size

Change View
50 μG
3 800,00 kr

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

3 800,00 kr


Please contact Customer Service for Availability

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

antigen ~7 kDa

species reactivity

human

technique(s)

western blot: 1 μg/mL

NCBI accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... HTN1(3346)

General description

Histatin 1 (HTN1) is a histidine-rich phosphoprotein.HTN1 functions as an antimicrobial peptide with 38 amino acids. It is highly enriched in human saliva. HTN1 gene is located on human chromosome 4q13.3.

Immunogen

HTN1 (NP_002150.1, 1 a.a. ~ 57 a.a) full-length human protein.

Sequence
MKFFVFALVLALMISMISADSHEKRHHGYRRKFHEKHHSHREFPFYGDYGSNYLYDN

Biochem/physiol Actions

Histatin 1 (HTN1) promotes migration of oral keratinocytes and fibroblasts in vitro. It also contributes to endothelial cell adhesion, migration and angiogenesis. HTN1 helps in oral wound healing. HTN1 is used as a marker for human lacrimal epithelium in accessory lacrimal gland (ALG) and cadaveric main lacrimal gland (MLG). HTN1 also has candidacidal activity and helps in mineralization by adsorbing to hydroxyapatite.

Physical form

Solution in phosphate buffered saline, pH 7.4

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Sushma Kalmodia et al.
Scientific reports, 9(1), 10304-10304 (2019-07-18)
The aims of this study were to determine if histatin-1 (H1) is present in normal human tears and whether tear levels of H1 varied between normal patients and those with aqueous deficient dry eye disease (ADDE). Patient samples were obtained
A review of protein structure and gene organisation for proteins associated with mineralised tissue and calcium phosphate stabilisation encoded on human chromosome 4
Huq N, et al.
Archives of Oral Biology, 50(7) (2005)
The salivary peptide histatin-1 promotes endothelial cell adhesion, migration, and angiogenesis
Torres , et al.
Faseb Journal, 31(11) (2017)
Histatin-1 expression in human lacrimal epithelium
Shah D, et al.
PLoS ONE, 11(1), e0148018-e0148018 (2016)
J Driscoll et al.
Journal of dental research, 74(12), 1837-1844 (1995-12-01)
Histatin 1 is a histidine-rich phosphoprotein present in human parotid saliva that possesses candidacidal activity and functions in mineralization by adsorbing to hydroxyapatite. The objective of the present study was to develop a system for recombinant production of histatin 1

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service