Skip to Content
Merck
All Photos(3)

Key Documents

SAB1401412

Sigma-Aldrich

Monoclonal Anti-MYST3 antibody produced in mouse

clone 4D8, purified immunoglobulin, buffered aqueous solution

Synonym(s):

KAT6A, MGC167033, MOZ, RUNXBP2, ZNF220

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

4D8, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

capture ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2bκ

NCBI accession no.

shipped in

dry ice

storage temp.

−20°C

Gene Information

human ... MYST3(7994)

General description

MOZ (monocytic leukemia zinc finger protein) is also known as lysine acetyltransferase 6 (KAT6A) and belongs to the MYST (MOZ, YBF2/SAS3, SAS2 and TIP60) family. The KAT6 gene is mapped to human chromosomes 8p11.21.{87] The structure of KAT6 is evolutionarily conserved in organisms ranging from yeast to mammals. The encoded protein contains a nuclear localization domain (including H15), a histone-acetyltransferase domain (HAT), an acidic glutamate/aspartate-rich region, a double-plant homeodomain finger that interacts with acetylated histone H3 tails (PHD 1 and 2) and a serine and methionine-rich region containing a transactivation domain. In humans, the gene is broadly expressed in different tissues, strongly in the brain and to a lesser extent in the heart.

Immunogen

MYST3 (NP_006757, 81 a.a. ~ 179 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
ALPKPRNHGKLDNKQNVDWNKLIKRAVEGLAESGGSTLKSIERFLKGQKDVSALFGGSAASGFHQQLRLAIKRAIGHGRLLKDGPLYRLNTKATNVDGK

Biochem/physiol Actions

KAT6A (lysine acetyltransferase 6A) is a histone acetyltransferase.{87] It is a transcriptional co-activator. It acetylates histone H3 at K14 and K9 and H4 at K5, K8, K12 and K16 in vitro. KAT6A is associated with the regulation of cell cycle and stem cell homeostasis. In acute myeloid leukemia, the involvement of KAT6A along with CREB binding protein has been observed. KAT6A acts as an oncogene. Mutations and abnormal regulation in KAT6 gene is associated with solid tumors and developmental disorders in human. It serves as a key epigenetic regulator of hematopoiesis. Mutations in the gene lead to abnormal acetylation of K9 and K18 of histone3 as well as changes in the P53 signaling. Therefore, affecting multiple cellular processes and controlling disease conditions.

Physical form

Solution in phosphate buffered saline, pH 7.4

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

12 - Non Combustible Liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Selective recognition of histone crotonylation by double PHD fingers of MOZ and DPF2.
Xiong X
Nature Chemical Biology, 12(12), 1111-1118 (2016)
Dominant mutations in KAT6A cause intellectual disability with recognizable syndromic features.
Tham E
American Journal of Human Genetics, 96(3), 507-513 (2015)
De novo nonsense mutations in KAT6A, a lysine acetyl-transferase gene, cause a syndrome including microcephaly and global developmental delay.
Arboleda VA
American Journal of Human Genetics, 96(3), 498-506 (2015)
Regulation of KAT6 Acetyltransferases and Their Roles in Cell Cycle Progression, Stem Cell Maintenance, and Human Disease.
Huang F
Molecular and Cellular Biology, 36(14), 1900-1907 (2016)
Brittany Turner-Ivey et al.
Neoplasia (New York, N.Y.), 16(8), 644-655 (2014-09-16)
The chromosome 8p11-p12 amplicon is present in 12% to 15% of breast cancers, resulting in an increase in copy number and expression of several chromatin modifiers in these tumors, including KAT6A. Previous analyses in SUM-52 breast cancer cells showed amplification

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service