HPA042199
Anti-GPSM1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Synonym(s):
Anti-AGS3, Anti-DKFZP727I051, Anti-G-Protein Signaling Modulator 1
Sign Into View Organizational & Contract Pricing
All Photos(2)
About This Item
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
technique(s)
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500
immunogen sequence
SPAASEKPDLAGYEAQGARPKRTQRLSAETWDLLRLPLEREQNGDSHHSGDWRGPSRDSLPLPVRSRK
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... GPSM1(26086)
General description
G-protein-signaling modulator 1 (GPSM1) is also called activator of G protein signalling 3 (AGS3). The GPSM1 gene is mapped to human chromosome 9q34.3. AGS3 has a N-terminal domain with seven tetratri-copeptides (TPR) repeats and the C-terminal domain with four G-protein regulatory motifs (GPR) or GoLocomotifs. Brain and testes express AGS3 in high levels.
Immunogen
G-protein signaling modulator 1 recombinant protein epitope signature tag (PrEST)
Application
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Biochem/physiol Actions
G-protein-signaling modulator 1 (GPSM1) or activator of G protein signalling 3 (AGS3) functions to regulate G protein signalling. AGS3 functions to orient mitotic spindle and modulates development of cerebral cortical progenitor cells during neurogenesis. The GPR motif of AGS3 cytokine may regulate cytokine production in airway inflammation. It also regulates autophagic pathway and protein trafficking. AGS3 is down regulated human esophageal squamous cell carcinoma. AGS3 is also less expressed in multiple myeloma. Abnormal expression of AGS3 in renal epithelium is implicated in polycystic kidney disease (PKD).(10) Defects in AGS3 gene locus is implicated in MORM syndrome (mental retardation, truncal obesity, retinal dystrophy and micropenis).
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Linkage
Corresponding Antigen APREST82026
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
AGS proteins, GPR motifs and the signals processed by heterotrimeric G proteins
Lanier SM
Biology of the Cell, 96(5), 369-372 (2004)
G protein betagamma subunits and AGS3 control spindle orientation and asymmetric cell fate of cerebral cortical progenitors
Sanada K and Tsai L
Cell, 122(1), 119-131 (2005)
The G-protein regulator AGS3 controls an early event during macroautophagy in human intestinal HT-29 cells
Pattingre S, et al.
The Journal of Biological Chemistry (2003)
A role for activator of G-protein signaling 3 (AGS3) in multiple myeloma
Shao S, et al.
International Journal of Hematology, 99(1), 57-68 (2014)
MORM syndrome (mental retardation, truncal obesity, retinal dystrophy and micropenis), a new autosomal recessive disorder, links to 9q34
Hampshire D, et al.
European Journal of Human Genetics, 14(5), 543-543 (2006)
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service