Skip to Content
Merck
All Photos(3)

Key Documents

HPA018911

Sigma-Aldrich

Anti-ARHGEF12 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-Leukemia-associated RhoGEF, Anti-Rho guanine nucleotide exchange factor 12

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
6 940,00 kr

6 940,00 kr


Please contact Customer Service for Availability


Select a Size

Change View
100 μL
6 940,00 kr

About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.43

6 940,00 kr


Please contact Customer Service for Availability

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:1000-1:2500

immunogen sequence

MAASVKEQSTKPIPLPQSTPGEGDNDEEDPSKLKEEQHGISVTGLQSPDRDLGLESTLISSKPQSHSLSTSGKSEVRDLFVAERQFAKEQHTDGTLKEVGEDYQ

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

General description

The gene ARHGEF12 (Rho guanine nucleotide exchange factor 12) is mapped to human chromosome 11q23.3. The protein contains a PDZ (PSD-95/Dlg/ZO-1) domain, a LH/RGS (regulator of G protein signaling) domain, a DH (Dbl homology) domain and a PH (pleckstrin homology) domain. It is highly expressed in glioma, gastric cancer and intestinal cancer cell lines. In MDCK (Madin-Darby canine kidney)-II epithelial cells, the protein localizes at the lateral membranes and in the cytoplasm. However, ARHGEF12 has also been shown to co-localize with α-tubulin at the spindle poles and during cytokinesis, it is present in the midbody.[1] ARHGEF12 is popularly called as LARG (Leukemia-associated RhoGEF).

Immunogen

Rho guanine nucleotide exchange factor 12 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

ARHGEF12 (Rho guanine nucleotide exchange factor-12) is a guanine nucleotide exchange factor. It connects G protein-coupled receptors (GPCRs) and heterotrimeric G proteins of the Gα12 family to Rho, thereby allowing cell surface receptors to activate Rho-dependent pathways. For instance, IGF1 (Insulin like growth factor 1) associates with ARHGEF12, thereby resulting in activation of Rho and Rho-associated kinase. Activation of Rho/Rho-kinase pathway induces cytoskeletal rearrangements in MDCK (Madin-Darby canine kidney)-II epithelial cells. ARHGEF12 binds to ATP-binding cassette transporter A1 (ABCA1). This interaction stabilizes ABCA1 and thus induces cholesterol efflux.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST74816

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Keiichiro Okuhira et al.
The Journal of biological chemistry, 285(21), 16369-16377 (2010-03-30)
ATP-binding cassette transporter A1 (ABCA1)-mediated lipid efflux to apolipoprotein A1 (apoA-I) initiates the biogenesis of high density lipoprotein. Here we show that the Rho guanine nucleotide exchange factors PDZ-RhoGEF and LARG bind to the C terminus of ABCA1 by a
Marc De Braekeleer et al.
Anticancer research, 25(3B), 1931-1944 (2005-09-15)
Reciprocal chromosomal translocations are recurrent features of many hematological malignancies. The cloning of the genes located at the breakpoints of chromosomal translocations in leukemia and lymphoma has led to the identification of new genes involved in carcinogenesis. Molecular studies of
S Fukuhara et al.
FEBS letters, 485(2-3), 183-188 (2000-11-30)
A putative guanine nucleotide exchange factor (GEF), termed leukemia-associated RhoGEF (LARG), was recently identified upon fusion to the coding sequence of the MLL gene in acute myeloid leukemia. Although the function of LARG is still unknown, it exhibits a number
S Taya et al.
The Journal of cell biology, 155(5), 809-820 (2001-11-29)
Insulin-like growth factor (IGF)-1 plays crucial roles in growth control and rearrangements of the cytoskeleton. IGF-1 binds to the IGF-1 receptor and thereby induces the autophosphorylation of this receptor at its tyrosine residues. The phosphorylation of the IGF-1 receptor is
Matthew K Martz et al.
Molecular biology of the cell, 24(18), 2785-2794 (2013-07-26)
Proper completion of mitosis requires the concerted effort of multiple RhoGEFs. Here we show that leukemia-associated RhoGEF (LARG), a RhoA-specific RGS-RhoGEF, is required for abscission, the final stage of cytokinesis, in which the intercellular membrane is cleaved between daughter cells.

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service