Skip to Content
Merck
All Photos(7)

Key Documents

HPA018790

Sigma-Aldrich

Anti-FAIM2 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-Fas apoptotic inhibitory molecule 2, Anti-Protein lifeguard, Anti-Transmembrane BAX inhibitor motif-containing protein 2

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
6 940,00 kr

6 940,00 kr


Please contact Customer Service for Availability


Select a Size

Change View
100 μL
6 940,00 kr

About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

6 940,00 kr


Please contact Customer Service for Availability

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

orthogonal RNAseq
independent
Learn more about Antibody Enhanced Validation

technique(s)

immunohistochemistry: 1:50- 1:200

immunogen sequence

MTQGKLSVANKAPGTEGQQQVHGEKKEAPAVPSAPPSYEEATSGE

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... FAIM2(23017)

General description

The gene Fas apoptotic inhibitory molecule-2 (FAIM2) is mapped to human chromosome 12q13. FAIM2 is widely distributed with higher expression in hippocampus. FAIM2 is a membrane-associated protein. The protein is present in the cytoplasm, at the cell membrane and has peri-nuclear staining. FAIM2 is popularly referred as LFG (Lifeguard).

Immunogen

Fas apoptotic inhibitory molecule 2 recombinant protein epitope signature tag (PrEST)

Application

Anti-FAIM2 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)

Biochem/physiol Actions

Fas apoptotic inhibitory molecule-2 (FAIM2) is an anti-apoptotic protein which protects from Fas-mediated cell death. FAIM2 is up-regulated in human breast cancer cell lines. The up-regulation of FAIM2 is proposed to suppress apoptosis in breast cancer cells. Anti-apoptotic nature of FAIM2 provides neuroprotection in cerebellar granule neurons and Purkinje cell. Single nucleotide polymorphism in FAIM2 is associated with increased risk of obesity.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST74197

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Simone C Tauber et al.
Journal of neuropathology and experimental neurology, 73(1), 2-13 (2013-12-18)
Fas-apoptotic inhibitory molecule 2 (Faim2) is a neuron-specific membrane protein and a member of the evolutionary conserved lifeguard apoptosis regulatory gene family. Its neuroprotective effect in acute neurological diseases has been demonstrated in an in vivo model of focal cerebral
Linlin Tang et al.
Diagnostic pathology, 9, 56-56 (2014-03-14)
The goal of our study is to investigate the associations between 18 candidate genetic markers and overweight/obesity. A total of 72 eligible articles were retrieved from literature databases including PubMed, Embase, SpingerLink, Web of Science, Chinese National Knowledge Infrastructure (CNKI)
Daniel Komnig et al.
Journal of neurochemistry, 145(3), 258-270 (2018-01-10)
Delayed cell death in the penumbra region of acute ischemic stroke occurs through apoptotic mechanisms, making it amenable to therapeutic interventions. Fas/CD95 mediates apoptotic cell death in response to external stimuli. In mature neurons, Fas/CD95 signaling is modulated by Fas-apoptotic
Tatiana Hurtado de Mendoza et al.
Proceedings of the National Academy of Sciences of the United States of America, 108(41), 17189-17194 (2011-10-01)
Lifeguard (LFG) is an inhibitor of Fas-mediated cell death and is highly expressed in the cerebellum. We investigated the biological role of LFG in the cerebellum in vivo, using mice with reduced LFG expression generated by shRNA lentiviral transgenesis (shLFG
Miriam Fernández et al.
Journal of neurochemistry, 103(1), 190-203 (2007-07-20)
Fas ligand (FasL)-receptor system plays an essential role in regulating cell death in the developing nervous system, and it has been implicated in neurodegenerative and inflammatory responses in the CNS. Lifeguard (LFG) is a protein highly expressed in the hippocampus

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service