Synthetic peptide directed towards the N terminal region of human RABGGTA
Application
Anti-RABGGTA antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/ml.
Biochem/physiol Actions
Rab geranylgeranyltransferase, alpha subunit (RABGGTA; PTAR3) an enzyme that attaches geranylgeranyl groups to Rab proteins. The activity of this enzyme is essential for hemostasis and platelet synthesis. Polymorphisms in RABGGTA gene have been observed in patients with Hermansky-Pudlak syndrome.
Sequence
Synthetic peptide located within the following region: ELAFTDSLITRNFSNYSSWHYRSCLLPQLHPQPDSGPQGRLPEDVLLKEL
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Molecular genetics and metabolism, 71(4), 599-608 (2001-01-04)
Hermansky-Pudlak syndrome (HPS) is a recessively inherited disease with dysfunction of several related subcellular organelles including platelet-dense granules, melanosomes, and lysosomes. Our recent identification of the mutation in murine Rab geranylgeranyl transferase alpha-subunit gene (Rabggta) in one mouse model of
Proceedings of the National Academy of Sciences of the United States of America, 97(8), 4144-4149 (2000-03-29)
Few molecular events important to platelet biogenesis have been identified. Mice homozygous for the spontaneous, recessive mutation gunmetal (gm) have prolonged bleeding, thrombocytopenia, and reduced platelet alpha- and delta-granule contents. Here we show by positional cloning that gm results from
Questions
Reviews
★★★★★ No rating value
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
