Skip to Content
Merck
All Photos(2)

Key Documents

AV32790

Sigma-Aldrich

Anti-ACAT2 (AB1) antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-Acetyl-coenzyme A acetyltransferase 2 (acetoacetyl coenzyme A thiolase)

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
3 190,00 kr

3 190,00 kr


Please contact Customer Service for Availability


Select a Size

Change View
100 μL
3 190,00 kr

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

3 190,00 kr


Please contact Customer Service for Availability

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

41 kDa

species reactivity

human, bovine, guinea pig, rat

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... ACAT2(39)

General description

ACAT2 is an acyl-coenzyme A cholesterol acyltransferase that regulates the esterification of cholesterol in cells. ACAT2 has been recommended as a treatment target for hypercholesterolemia and atherosclerosis. It has also been implicated in the inhibition of apoB secretion in liver cells.
Rabbit Anti-ACAT2 (AB1) antibody recognizes bovine, human, mouse, and rat ACAT2.

Immunogen

Synthetic peptide directed towards the middle region of human ACAT2

Application

Rabbit Anti-ACAT2 (AB1) antibody can be used for western blot applications at a concentration of 1 μg/ml. It can also be used for IHC applications at 4-8 μg/ml.

Biochem/physiol Actions

Acetyl-Coenzyme A acetyltransferase 2 is an enzyme involved in lipid metabolism. Reported patients with ACAT2 deficiency have shown severe mental retardation and hypotonus. The ACAT2 gene shows complementary overlapping with the 3-prime region of the TCP1 gene in both mouse and human. These genes are encoded on opposite strands of DNA, as well as in opposite transcriptional orientation.

Sequence

Synthetic peptide located within the following region: SREDQDKVAVLSQNRTENAQKAGHFDKEIVPVLVSTRKGLIEVKTDEFPR

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

L J Wilcox et al.
Journal of lipid research, 42(5), 725-734 (2001-05-16)
The citrus flavonoids, naringenin and hesperetin, lower plasma cholesterol in vivo. However, the underlying mechanisms are not fully understood. The ability of these flavonoids to modulate apolipoprotein B (apoB) secretion and cellular cholesterol homeostasis was determined in the human hepatoma
Paolo Parini et al.
Circulation, 110(14), 2017-2023 (2004-09-29)
Two acyl-coenzyme A:cholesterol acyltransferase (ACAT) genes, ACAT1 and ACAT2, have been identified that encode 2 proteins responsible for intracellular cholesterol esterification. In this study, immunohistology was used to establish their cellular localization in human liver biopsies. ACAT2 protein expression was

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service