Skip to Content
Merck
All Photos(1)

Key Documents

HPA039255

Sigma-Aldrich

Anti-NPAS4 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-BHLHe79, Anti-Le-PAS, Anti-NXF, Anti-Neuronal PAS domain protein 4, Anti-PASD10

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunohistochemistry: 1:50- 1:200

immunogen sequence

YLTFPSGPEPSLQAELSKDLVCTPPYTPHQPGGCAFLFSLHEPFQTHLPTPSSTLQEQLTPSTATFSDQLTPSSATFPDPLTSPLQGQLTETS

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... NPAS4(266743)

General description

The gene NPAS4 (neuronal PAS domain protein 4) is mapped to human chromosome 11q13. It is also referred to as NXF (neuronal transcription factor) and LE-PAS (limbic-enriched PAS domain protein). The encoded protein belongs to the basic helix-loop-helix (bHLH)-PAS (Per-ARNT-Sim) protein family. NPAS4 is mainly expressed in the brain and low levels are also present in the testis. The protein is present in the nucleus.
NPAS4 protein interacts with:

Immunogen

neuronal PAS domain protein 4 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-NPAS4 antibody produced in rabbit has been used in western blotting.

Biochem/physiol Actions

NPAS4 (neuronal PAS domain protein 4) is an activity-related transcription factor. It controls inhibitory and excitatory synapse formation. This action of NPAS4 depends on the neuronal cell type. NPAS4 also regulates the expression of brain-derived neurotrophic factor (BDNF), a neurotrophin required for neuronal viability, differentiation and synaptic plasticity. NPAS4 is associated with cognitive and social neurobehavior. In addition, it is involved in hippocampus- and amygdala-linked learning and memory. NPAS4 is also linked with psychiatric disorders, including bipolar disorder, autism spectrum disorder and cognition-associated disorders. This gene is also expressed during ischemic stroke and protects neurons against neurodegenerative insults.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST80909

Physical form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Identification of a novel basic helix-loop-helix-PAS factor, NXF, reveals a Sim2 competitive, positive regulatory role in dendritic-cytoskeleton modulator drebrin gene expression.
Ooe N, et al.
Molecular and Cellular Biology, 24, 608-608 (2004)
Epigenetic mechanisms in the development of memory and their involvement in certain neurological diseases.
Rosales-Reynoso MA, et al.
Neurologia (Barcelona, Spain), 31, 628-638 (2016)
The Role of the Neuroprotective Factor Npas4 in Cerebral Ischemia.
Choy FC, et al.
International Journal of Molecular Sciences, 16, 29011-29028 (2015)
Thilo Speckmann et al.
The Journal of biological chemistry, 291(6), 2682-2695 (2015-12-15)
Cytosolic calcium influx activates signaling pathways known to support pancreatic beta cell function and survival by modulating gene expression. Impaired calcium signaling leads to decreased beta cell mass and diabetes. To appreciate the causes of these cytotoxic perturbations, a more

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service