SAB1404621

Monoclonal Anti-RIPK2, (C-terminal) antibody produced in mouse

clone 6F7, purified immunoglobulin, buffered aqueous solution

• Synonym(s): CARD3, CARDIAK, CCK, GIG30, RICK, RIP2
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• Quality Level: 100
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 6F7, monoclonal
• form: buffered aqueous solution
• mol wt: antigen ~38.21 kDa
• species reactivity: mouse, human, rat
• technique(s): capture ELISA: suitable; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG2aκ
• NCBI accession no.: BC004553
• UniProt accession no.: O43353
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... RIPK2(8767)

Description

General description

Receptor interacting serine/threonine kinase 2 (RIPK2) belongs to the RIP kinase family. The protein contains a caspase activation and recruitment domain (CARD) at the C-terminal, N-terminal kinase domain, and a bridging intermediate domain. The gene is mapped to human chromosome 8q21.3.

This gene encodes a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases. The encoded protein contains a C-terminal caspase activation and recruitment domain (CARD), and is a component of signaling complexes in both the innate and adaptive immune pathways. It is a potent activator of NF-kappaB and inducer of apoptosis in response to various stimuli. (provided by RefSeq)

Immunogen

RIPK2 (AAH04553, 431 a.a. ~ 540 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LQPGIAQQWIQSKREDIVNQMTEACLNQSLDALLSRDLIMKEDYELVSTKPTRTSKVRQLLDTTDIQGEEFAKVIVQKLKDNKQMGLQPYPEILVVSRSPSLNLLQNKSM

Application

Monoclonal Anti-RIPK2, (C-terminal) antibody produced in mouse has been used in immunoblotting (1:500).

Biochem/physiol Actions

Receptor interacting serine/threonine kinase 2 (RIPK2) is a key regulator of the immune and inflammatory pathways. It is a potent activator of nuclear factor (NF)-κB via nucleotide-binding and oligomerization domain (NOD) receptor. RIPK2 is associated with the progression and aggressiveness, tumor size, metastasis, and overall stagging in various types of cancers. Overexpression of RIPK2 is observed in the head and neck squamous cell carcinoma (HNSCC), gastric cancer, colorectal cancer (CRC), and lethal prostate cancers. It is found to induce cell proliferation and inhibit apoptosis in glioma and breast cancer. RIPK2 polymorphism is also associated with the onset of bladder cancer.

Physical form

Solution in phosphate buffered saline, pH 7.4

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable