Skip to Content
Merck
All Photos(1)

Key Documents

HPA010725

Sigma-Aldrich

Anti-C1orf43 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-HCV NS5A-transactivated protein 4 antibody produced in rabbit, Anti-Hepatitis C virus NS5A-transactivated protein 4 antibody produced in rabbit, Anti-Protein NICE-3 antibody produced in rabbit, Anti-S863-3 antibody produced in rabbit, Anti-Uncharacterized protein C1orf43 antibody produced in rabbit

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunohistochemistry: 1:200- 1:500

immunogen sequence

AMKSRRGPHVPVGHNAPKDLKEEIDIRLSRVQDIKYEPQLLADDDARLLQLETQGNQSCYNYLYRMKALDAIRTS

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... C1orf43(25912)

General description

C1orf43 (chromosome 1 open reading frame 43) belongs to epidermal differentiation complex (EDC) family of genes. It is mapped to human chromosome 1q21, and has three cDNA variants owing to alternative splicing. It might have the structural characteristics of N-4 cytosine-specific DNA methylases, and is expressed in multiple tissues. It is also found in CD34+ hematopoietic stem cells (HSPCs). C1orf43 gene shares no homology with any of the existing EDC families.

Immunogen

Uncharacterized protein C1orf43 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

EDC (epidermal differentiation complex) family of genes is responsible for the normal maturation of epidermis and is therefore, linked with skin diseases. EDC is also associated with carcinogenesis, and the expression of C1orf43 is found to be up-regulated in human hepatocellular carcinoma (HCC). Increased expression of this gene in Focus and WRL-68 HCC cell lines leads to cell proliferation and colony formation. Studies also suggest that this protein is induced by NS5A (non-structural protein 5A) present in hepatitis C virus (HCV). Therefore, C1orf43 might lead to HCV-related HCC. Fibrolamellar carcinomas (FLC), a rare form of HCC, also shows increased levels of C1orf43 expression. Hence, C1orf43 might be an oncogene for HCC. The up-regulation of this gene can also act as a marker for poor prognosis, and determination of malignance in breast cancer.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST72033

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

I Marenholz et al.
Genome research, 11(3), 341-355 (2001-03-07)
The epidermal differentiation complex (EDC) comprises a large number of genes that are of crucial importance for the maturation of the human epidermis. So far, 27 genes of 3 related families encoding structural as well as regulatory proteins have been
Yuan-Jiang Wei et al.
Asian Pacific journal of cancer prevention : APJCP, 13(9), 4363-4368 (2012-11-22)
The epidermal differentiation complex (EDC) contains a large number of gene products which are crucial for the maturation of the human epidermis and can contribute to skin diseases, even carcinogenesis. It is generally acepted that activation of oncogenes and/or inactivation

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service